Lus10008649 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44310 177 / 2e-58 Calcium-binding EF-hand family protein (.1)
AT4G38810 49 / 2e-07 Calcium-binding EF-hand family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035578 279 / 3e-98 AT2G44310 182 / 3e-60 Calcium-binding EF-hand family protein (.1)
Lus10009192 86 / 4e-22 AT2G44310 94 / 1e-25 Calcium-binding EF-hand family protein (.1)
Lus10026291 44 / 2e-05 AT4G38810 481 / 9e-171 Calcium-binding EF-hand family protein (.1.2)
Lus10007567 42 / 7e-05 AT4G38810 499 / 6e-178 Calcium-binding EF-hand family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G231100 197 / 7e-66 AT2G44310 221 / 2e-75 Calcium-binding EF-hand family protein (.1)
Potri.014G161200 134 / 5e-41 AT2G44310 143 / 1e-44 Calcium-binding EF-hand family protein (.1)
Potri.002G218500 130 / 1e-39 AT2G44310 140 / 7e-44 Calcium-binding EF-hand family protein (.1)
Potri.002G218700 125 / 8e-38 AT2G44310 137 / 3e-42 Calcium-binding EF-hand family protein (.1)
Potri.002G218750 125 / 1e-37 AT2G44310 136 / 3e-42 Calcium-binding EF-hand family protein (.1)
Potri.002G218300 125 / 1e-37 AT2G44310 138 / 9e-43 Calcium-binding EF-hand family protein (.1)
Potri.002G219000 125 / 2e-37 AT2G44310 137 / 1e-42 Calcium-binding EF-hand family protein (.1)
Potri.002G218800 125 / 2e-37 AT2G44310 137 / 1e-42 Calcium-binding EF-hand family protein (.1)
Potri.002G218201 124 / 4e-37 AT2G44310 136 / 4e-42 Calcium-binding EF-hand family protein (.1)
Potri.002G218725 123 / 9e-37 AT2G44310 135 / 1e-41 Calcium-binding EF-hand family protein (.1)
PFAM info
Representative CDS sequence
>Lus10008649 pacid=23180099 polypeptide=Lus10008649 locus=Lus10008649.g ID=Lus10008649.BGIv1.0 annot-version=v1.0
ATGGGAGTGGTGGTAATCGACGGAACGACGGTGAAGGATTTCGCGGAGAACGAGGCGCACTTCAACAAGAGCGGCGAAGAGCCCTTCGCGTTACTGGACG
TCAACAACGACGGCGTACTGTCCCGGTCGGAGCTCCGGCGAGGATTCGAGACGCTCCGCCTTCTGGACAACGACTTCGGCTTCGACACACCGGCGCGCCC
CGACGAGCTGACCAAGCTGTACGACTCCATCTTCGACAAGTTCGACGACAACCACAACGGGACTGTGGATCTGGAAGAGTACCGTTCGGAGGTGAAGAAG
ATCCTGCTGGCGATCGCCGAGGGATTGGGCTCCAACCCGATCCAGATGGCGTTGGAGGAGAATGACGACCACAGCTTCCTGAGGAAAGCCGCCCAGCTCG
AGGCCTCTAAAGTTGCTAACGCCACCGCAGGTCCCTAA
AA sequence
>Lus10008649 pacid=23180099 polypeptide=Lus10008649 locus=Lus10008649.g ID=Lus10008649.BGIv1.0 annot-version=v1.0
MGVVVIDGTTVKDFAENEAHFNKSGEEPFALLDVNNDGVLSRSELRRGFETLRLLDNDFGFDTPARPDELTKLYDSIFDKFDDNHNGTVDLEEYRSEVKK
ILLAIAEGLGSNPIQMALEENDDHSFLRKAAQLEASKVANATAGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44310 Calcium-binding EF-hand family... Lus10008649 0 1
AT2G44310 Calcium-binding EF-hand family... Lus10035578 4.0 0.8883
AT1G22850 SNARE associated Golgi protein... Lus10006162 4.0 0.9010
AT4G04640 ATPC1 ATPase, F1 complex, gamma subu... Lus10002078 6.6 0.9186
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Lus10012452 8.1 0.9143
AT3G12345 unknown protein Lus10040344 10.2 0.9111
AT5G52420 unknown protein Lus10027495 13.2 0.8951
AT5G23060 CaS calcium sensing receptor (.1) Lus10000867 14.0 0.8915
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Lus10020508 18.3 0.8955
AT3G27925 DEGP, DegP1, DE... DegP protease 1 (.1) Lus10022234 24.3 0.8647
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Lus10006188 25.3 0.8879

Lus10008649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.