Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25240 39 / 0.0002 Serine protease inhibitor (SERPIN) family protein (.1) AT1G47710 39 / 0.0003 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019009 [exp] 47 / 3e-07 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1) Lus10039336 [exp] 39 / 0.0003 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G036000 [exp] 43 / 5e-06 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1) Potri.017G100900 [exp] 41 / 3e-05 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00079 [flax] [poplar] Serpin Serpin (serine protease inhibitor)
Representative CDS sequence Show only first row Show all	>Lus10008653 pacid=23161955 polypeptide=Lus10008653 locus=Lus10008653.g ID=Lus10008653.BGIv1.0 annot-version=v1.0 ATGAAGGTTCTTGCCGATGTCTACCGGGCTGAAACTAACCCCGACAGGTTCGAGCCTAAGGATACGATGAAGATGTTGGATCTGGAGCTGCCGTTTGAGA TGAATAATAAGGACTTCACGGAGATGCTGGTTGGTGGGGATGGCGAATCGGTGTGTATCGAGAAGGTGACACAGAGCGCTTACATTGATGTAGATGAGAA GGGTACGGAAGGTGGTGCCGTCTCAGCAAATTGTGTTGTGACATGTTCGAAGGGTCCGCCCAAGGTTCTCCAGCGGACCATCCGTTCATGTACATGA
AA sequence Show only first row Show all	>Lus10008653 pacid=23161955 polypeptide=Lus10008653 locus=Lus10008653.g ID=Lus10008653.BGIv1.0 annot-version=v1.0 MKVLADVYRAETNPDRFEPKDTMKMLDLELPFEMNNKDFTEMLVGGDGESVCIEKVTQSAYIDVDEKGTEGGAVSANCVVTCSKGPPKVLQRTIRSCT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008653 [exp]	0	1
					Lus10010418 [exp]	5.7	0.6841
AT5G52975			Protein of unknown function (D...		Lus10032886 [exp]	9.4	0.6390
AT1G52790			2-oxoglutarate (2OG) and Fe(II...		Lus10005776 [exp]	12.1	0.6121
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10003652 [exp]	15.2	0.5937
					Lus10039435 [exp]	18.0	0.5722
AT5G16460			Putative adipose-regulatory pr...		Lus10020213 [exp]	20.2	0.5615
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10027816 [exp]	20.7	0.5803
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Lus10040425 [exp]	25.5	0.5670
					Lus10003636 [exp]	25.8	0.5670
AT1G07175			unknown protein		Lus10040655 [exp]	26.5	0.5631

Compare expression of checked genes

Lus10008653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.