Lus10008656 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05200 44 / 1e-05 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT4G21230 39 / 0.0005 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
AT3G21940 38 / 0.001 Receptor protein kinase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026169 161 / 5e-52 AT4G05200 51 / 4e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10026168 80 / 2e-19 ND 37 / 0.005
Lus10026629 50 / 6e-08 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10028026 46 / 6e-07 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Lus10020834 45 / 1e-06 AT1G70520 46 / 3e-06 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1)
Lus10018379 45 / 4e-06 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10014362 44 / 6e-06 AT5G48540 39 / 6e-04 receptor-like protein kinase-related family protein (.1)
Lus10020833 42 / 2e-05 AT4G23260 47 / 1e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2)
Lus10008657 57 / 5e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 53 / 1e-09 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G026350 47 / 5e-07 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G027900 45 / 5e-06 AT4G23180 542 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028100 44 / 9e-06 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025900 42 / 3e-05 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G024900 42 / 3e-05 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025200 42 / 6e-05 AT4G23180 665 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023788 42 / 6e-05 AT4G23180 559 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024052 42 / 7e-05 AT4G23180 545 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025001 41 / 9e-05 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10008656 pacid=23161956 polypeptide=Lus10008656 locus=Lus10008656.g ID=Lus10008656.BGIv1.0 annot-version=v1.0
ATGCCTAATTTCATCTCTGCTACGGTCATACCAAGAGGAATCAGCTGGACGACGGTCGTTTTGTGCCAACCCGCGGGCATAGGAGTTCCAGTCTGCAACA
GCAGGAAGATACACGACGGGGACCCGTTCGCCGGAGCATTGGTGGATGTCCTGAGGACGATATGGATCCACGTGGACGTGCTGGTAAAATATCCTTCTGC
TCAACACTGCTACGACGGTCATGATACGTATCAGCTTACCACTGCGTACGGTTCGGCGTCTTGTTCCGTCGGGCTTACCAATAAAGATTGCTCGGCGAGC
TTGTACGACGCATTGACTATAATTGATACTGCTTGTGGGAGGACTTACGGGGCTCAAGTCACCACTTCCACCTGTTTCTTGAGGTTCGAGTCTTATTCTT
TCTGCTAG
AA sequence
>Lus10008656 pacid=23161956 polypeptide=Lus10008656 locus=Lus10008656.g ID=Lus10008656.BGIv1.0 annot-version=v1.0
MPNFISATVIPRGISWTTVVLCQPAGIGVPVCNSRKIHDGDPFAGALVDVLRTIWIHVDVLVKYPSAQHCYDGHDTYQLTTAYGSASCSVGLTNKDCSAS
LYDALTIIDTACGRTYGAQVTTSTCFLRFESYSFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Lus10008656 0 1
AT5G53820 Late embryogenesis abundant pr... Lus10007566 5.2 0.7997
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10008978 7.3 0.7997
AT4G35160 O-methyltransferase family pro... Lus10032304 8.0 0.7241
AT4G35260 IDH-I, IDH1 isocitrate dehydrogenase I, is... Lus10014436 9.0 0.7997
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Lus10015428 10.4 0.7997
Lus10033071 11.6 0.7997
Lus10003695 12.7 0.7997
Lus10003774 13.7 0.7997
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10005596 14.7 0.7997
AT3G55700 UDP-Glycosyltransferase superf... Lus10040724 15.6 0.7997

Lus10008656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.