Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41180 44 / 4e-06 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1) AT3G56710 44 / 5e-06 SIB1 sigma factor binding protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026165 [exp] 193 / 5e-65 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1) Lus10039494 [exp] 74 / 1e-17 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10024139 [exp] 73 / 4e-17 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1) Lus10039493 [exp] 73 / 4e-17 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1) Lus10038985 [exp] 45 / 2e-06 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1) Lus10027279 [exp] 42 / 2e-05 AT3G56710 46 / 2e-06 sigma factor binding protein 1 (.1) Lus10022005 [exp] 41 / 4e-05 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1) Lus10005523 [exp] 41 / 5e-05 ND 46 / 2e-06 Lus10006569 [exp] 39 / 0.0002 ND 44 / 1e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G194700 [exp] 70 / 3e-16 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1) Potri.001G029700 [exp] 69 / 6e-16 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1) Potri.016G036600 [exp] 48 / 9e-08 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1) Potri.006G038900 [exp] 45 / 8e-07 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.013G043800 [exp] 41 / 2e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G093900 [exp] 41 / 3e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.019G013750 [exp] 40 / 5e-05 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1) Potri.019G013300 [exp] 40 / 6e-05 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G046000 [exp] 39 / 0.0004 AT3G58000 120 / 1e-34 VQ motif-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [flax] [poplar] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Lus10008659 pacid=23161933 polypeptide=Lus10008659 locus=Lus10008659.g ID=Lus10008659.BGIv1.0 annot-version=v1.0 ATGAAGAACAGCAAAGCTGCAGGTGGCAGGCGGGAGATGAAAAGGGACGTCGTACTGAAAGTTGTGTACATTTCAACTCCAATGAAGGTGAAAACGACGG AGGCCGGGTTCAAGAATCTGGTACAAGAGCTCACCGGGAAGGATTCCGATACGGCCAGGCTCATGGAGCAGCAGCAGGACTTCAACTTGATGATGGTGGA GGAAGAAGAAACAGCTAAAAGTGATCATGATCAGGCCGGTATGTGGACCAGTTCGGATAGTACGACGACCTCGGGTTTGGATGCATTTGATGAGTGTGAT CATCAAGGGTCGTTCATGAGCATGGTTCAGTCCAGTATTTTTGATGACTTGTGTCAGTTTGATGCCTTTAATGGTTAG
AA sequence Show only first row Show all	>Lus10008659 pacid=23161933 polypeptide=Lus10008659 locus=Lus10008659.g ID=Lus10008659.BGIv1.0 annot-version=v1.0 MKNSKAAGGRREMKRDVVLKVVYISTPMKVKTTEAGFKNLVQELTGKDSDTARLMEQQQDFNLMMVEEEETAKSDHDQAGMWTSSDSTTTSGLDAFDECD HQGSFMSMVQSSIFDDLCQFDAFNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008659 [exp]	0	1
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10024061 [exp]	6.2	0.8958
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10013589 [exp]	6.9	0.9001
AT4G36500			unknown protein		Lus10014291 [exp]	8.9	0.8839
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10020773 [exp]	12.8	0.8492
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10030472 [exp]	16.1	0.8183
AT1G11410			S-locus lectin protein kinase ...		Lus10005053 [exp]	16.2	0.8058
AT1G56240		ATPP2-B13	phloem protein 2-B13 (.1)		Lus10031471 [exp]	17.7	0.8625
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031473 [exp]	18.7	0.8578
AT4G39230			NmrA-like negative transcripti...		Lus10026351 [exp]	19.7	0.8182
AT5G07100	WRKY	WRKY26	WRKY DNA-binding protein 26 (....		Lus10042243 [exp]	21.6	0.8535

Compare expression of checked genes

Lus10008659 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.