Lus10008682 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02340 147 / 2e-44 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15960 134 / 1e-38 alpha/beta-Hydrolases superfamily protein (.1)
AT3G05600 130 / 1e-37 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15955 124 / 1e-35 alpha/beta-Hydrolases superfamily protein (.1.2.3)
AT3G51000 101 / 1e-26 alpha/beta-Hydrolases superfamily protein (.1)
AT2G26740 100 / 2e-26 ATSEH soluble epoxide hydrolase (.1)
AT2G26750 99 / 1e-25 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008683 209 / 1e-68 AT4G02340 428 / 1e-151 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008684 162 / 3e-50 AT4G02340 369 / 1e-128 alpha/beta-Hydrolases superfamily protein (.1)
Lus10026141 159 / 7e-49 AT4G02340 446 / 6e-159 alpha/beta-Hydrolases superfamily protein (.1)
Lus10004439 149 / 7e-45 AT4G02340 384 / 3e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10009859 137 / 2e-41 AT4G02340 349 / 6e-122 alpha/beta-Hydrolases superfamily protein (.1)
Lus10010293 135 / 1e-39 AT4G02340 476 / 1e-170 alpha/beta-Hydrolases superfamily protein (.1)
Lus10020663 135 / 1e-39 AT3G05600 416 / 1e-146 alpha/beta-Hydrolases superfamily protein (.1)
Lus10026139 128 / 3e-39 AT4G15960 115 / 6e-32 alpha/beta-Hydrolases superfamily protein (.1)
Lus10029878 132 / 1e-38 AT3G05600 425 / 3e-150 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G127200 154 / 3e-47 AT4G02340 519 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G202700 152 / 2e-46 AT4G02340 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G081000 137 / 4e-40 AT4G02340 455 / 1e-161 alpha/beta-Hydrolases superfamily protein (.1)
Potri.013G013500 134 / 3e-39 AT3G05600 425 / 2e-150 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010800 127 / 1e-36 AT4G15960 413 / 1e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010700 125 / 1e-35 AT4G15960 404 / 2e-141 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010900 124 / 3e-35 AT4G15960 412 / 3e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G023400 108 / 3e-30 AT3G05600 238 / 8e-79 alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G018900 103 / 1e-27 AT3G51000 454 / 9e-162 alpha/beta-Hydrolases superfamily protein (.1)
Potri.011G048000 66 / 2e-13 AT3G51000 219 / 2e-69 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10008682 pacid=23161928 polypeptide=Lus10008682 locus=Lus10008682.g ID=Lus10008682.BGIv1.0 annot-version=v1.0
ATGTCTTCATTTCATCCGATCATATCATCTGTCTCGATTCTCCATGAGGCTGAGTTTGCCGAGGTCGGGTTCGGAGGGTCGCCGGATCCTCCCTGTTTGC
CGTCGTGGTTGACCCAGGAGGATGTTGAATATTATGCTGGCAAGTTTGACAAGACCGGGTTCACCGGCGGACTCAACTACTACCGAGCTATTGATCTGAC
ATGGGAGACGATGGCGGCCTGGACGGGGGCGAAAGTGATGGTGCCGGCGAAGTTCGTTGCAGGGGAGTTAGACTTGACGCTGAAGTTTCCCGGGACGGAG
GAATACATCAATGGCGGAGGGTTCAAGGAATATGTGCCGCTGCTGGAGGAGGTTATTCTGCTGAAAGATGTGGGTCACTTTCGCATCAAAAGAGAGCCTC
GATGA
AA sequence
>Lus10008682 pacid=23161928 polypeptide=Lus10008682 locus=Lus10008682.g ID=Lus10008682.BGIv1.0 annot-version=v1.0
MSSFHPIISSVSILHEAEFAEVGFGGSPDPPCLPSWLTQEDVEYYAGKFDKTGFTGGLNYYRAIDLTWETMAAWTGAKVMVPAKFVAGELDLTLKFPGTE
EYINGGGFKEYVPLLEEVILLKDVGHFRIKREPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02340 alpha/beta-Hydrolases superfam... Lus10008682 0 1
AT1G65450 HXXXD-type acyl-transferase fa... Lus10029920 2.6 0.9739
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10007909 3.5 0.9687
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10034348 3.7 0.9739
Lus10015636 4.1 0.8897
AT2G23945 Eukaryotic aspartyl protease f... Lus10019960 4.4 0.8759
AT5G37060 ATCHX24 cation/H+ exchanger 24, ARABID... Lus10031852 5.3 0.9633
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10011999 5.9 0.9587
Lus10011637 6.5 0.9538
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029377 7.9 0.9504
AT1G52190 Major facilitator superfamily ... Lus10008539 8.0 0.9424

Lus10008682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.