Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09500 162 / 1e-52 Ribosomal protein S19 family protein (.1) AT1G04270 162 / 2e-52 RPS15 cytosolic ribosomal protein S15 (.1.2) AT5G09510 162 / 2e-52 Ribosomal protein S19 family protein (.1.2) AT5G43640 158 / 7e-51 Ribosomal protein S19 family protein (.1) AT5G09490 155 / 6e-50 Ribosomal protein S19 family protein (.1) AT5G63070 116 / 2e-34 Ribosomal protein S19 family protein (.1) AT1G33850 43 / 2e-06 Ribosomal protein S19 family protein (.1) ATCG00820 41 / 1e-05 ATCG00820.1, RPS19 ribosomal protein S19 (.1) AT5G47320 40 / 8e-05 RPS19 ribosomal protein S19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026127 [exp] 214 / 5e-73 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1) Lus10007469 [exp] 172 / 2e-56 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1) Lus10033856 [exp] 166 / 5e-54 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2) Lus10018777 [exp] 163 / 9e-53 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2) Lus10041168 [exp] 157 / 4e-49 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10024865 [exp] 139 / 1e-43 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1) Lus10021886 [exp] 142 / 2e-42 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10027711 [exp] 49 / 2e-08 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1) Lus10003009 [exp] 49 / 2e-07 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G076900 [exp] 164 / 2e-53 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2) Potri.002G043200 [exp] 160 / 8e-52 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1) Potri.005G219700 [exp] 159 / 1e-51 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1) Potri.008G161901 [exp] 119 / 1e-36 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2) Potri.005G055401 [exp] 71 / 2e-17 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2) Potri.003G123750 [exp] 55 / 2e-11 AT1G04270 67 / 4e-16 cytosolic ribosomal protein S15 (.1.2) Potri.005G055534 [exp] 54 / 3e-10 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2) Potri.013G129600 [exp] 44 / 3e-06 AT5G47320 103 / 2e-28 ribosomal protein S19 (.1) Potri.011G074301 [exp] 42 / 4e-06 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1) Potri.013G137688 [exp] 42 / 4e-06 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00203 [flax] [poplar] Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence Show only first row Show all	>Lus10008692 pacid=23161974 polypeptide=Lus10008692 locus=Lus10008692.g ID=Lus10008692.BGIv1.0 annot-version=v1.0 ATGGCGGAAGCAGATCAGGTTGCAGCAGTAGAGGTTCCCCTCCAGGCGAAGAAGAGCAGAACTTTCAAGCAGTTCAGCTACAGGGGAAAGGATTTGGATG CCCTCCTCGACATGTCGACCGACGAGCGTCCGGCGATGGTGAGGACCCACCTGAGGGACATGATAATCGTGCCGGAGATGATCGGAAGCGTGGTCGGGGT GTACAACGGGAGGACGTTTGTTCAGTACGAGGTGAAGCCAGAGATGATTGGTCACTACTTGGCCGAGTTTGCTATCACGTACAAGCCAGTGAGTCACGGG AGACCTGGTATGGGTGCAACTCACTCTTCCAGGTTCATTCCTCTCAAGTGA
AA sequence Show only first row Show all	>Lus10008692 pacid=23161974 polypeptide=Lus10008692 locus=Lus10008692.g ID=Lus10008692.BGIv1.0 annot-version=v1.0 MAEADQVAAVEVPLQAKKSRTFKQFSYRGKDLDALLDMSTDERPAMVRTHLRDMIIVPEMIGSVVGVYNGRTFVQYEVKPEMIGHYLAEFAITYKPVSHG RPGMGATHSSRFIPLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09490			Ribosomal protein S19 family p...		Lus10008692 [exp]	0	1

Compare expression of checked genes

Lus10008692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.