Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20040 46 / 6e-07 Pectin lyase-like superfamily protein (.1) AT4G20050 44 / 2e-06 QRT3 QUARTET 3, Pectin lyase-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026120 [exp] 116 / 5e-32 AT4G20040 406 / 6e-138 Pectin lyase-like superfamily protein (.1) Lus10033240 [exp] 58 / 6e-11 AT4G20040 449 / 1e-154 Pectin lyase-like superfamily protein (.1) Lus10038369 [exp] 57 / 1e-10 AT4G20040 439 / 6e-151 Pectin lyase-like superfamily protein (.1) Lus10008272 [exp] 52 / 5e-09 AT4G20040 453 / 4e-156 Pectin lyase-like superfamily protein (.1) Lus10001376 [exp] 50 / 2e-08 AT4G20040 417 / 4e-142 Pectin lyase-like superfamily protein (.1) Lus10038370 [exp] 47 / 3e-07 AT4G20050 386 / 3e-131 QUARTET 3, Pectin lyase-like superfamily protein (.1.2) Lus10036231 [exp] 47 / 3e-07 AT4G20050 493 / 2e-172 QUARTET 3, Pectin lyase-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G075300 [exp] 58 / 4e-11 AT4G20040 521 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.003G075500 [exp] 57 / 1e-10 AT4G20040 546 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.003G075400 [exp] 56 / 2e-10 AT4G20040 530 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.003G074600 [exp] 43 / 7e-06 AT4G20050 602 / 0.0 QUARTET 3, Pectin lyase-like superfamily protein (.1.2) Potri.001G159900 [exp] 41 / 2e-05 AT4G20050 604 / 0.0 QUARTET 3, Pectin lyase-like superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008700 pacid=23161973 polypeptide=Lus10008700 locus=Lus10008700.g ID=Lus10008700.BGIv1.0 annot-version=v1.0 ATGACGGTGGCCGGGAAAGGGACCAAATGGGTGGCCGATTTCAACGACGTGCTGCTATTTCCCGACAAGATTGATCATTTCCAGTACTCGTTTGCCGTAC TCAATAAGGAGAAGGAGAAGAAGAATAGTGTGGGCTGGGGTGGGCCTAGGTCTCCGATTCATGCGCCGGCGACGAACGTGTCGGGGAATGTGGTGGTGGT GGAGAGCGAGGATGAGGTGGACGGACTTGTTTCGGTGGTGGTCGATCAGTTTAATCCCATCACTAAGGAAACTAAGGACGTTCATTTTCCTTGA
AA sequence Show only first row Show all	>Lus10008700 pacid=23161973 polypeptide=Lus10008700 locus=Lus10008700.g ID=Lus10008700.BGIv1.0 annot-version=v1.0 MTVAGKGTKWVADFNDVLLFPDKIDHFQYSFAVLNKEKEKKNSVGWGGPRSPIHAPATNVSGNVVVVESEDEVDGLVSVVVDQFNPITKETKDVHFP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G20040			Pectin lyase-like superfamily ...		Lus10008700 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000682 [exp]	1.4	1.0000
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10032339 [exp]	2.4	1.0000
					Lus10003753 [exp]	2.4	1.0000
AT3G27470			Protein of unknown function (D...		Lus10035228 [exp]	2.8	0.9631
AT1G59610		DRP2B, CF1, ADL...	Dynamin related protein 2B, dy...		Lus10024462 [exp]	3.2	0.9363
AT2G37370			unknown protein		Lus10009063 [exp]	4.9	0.9356
AT4G30720		PDE327	PIGMENT DEFECTIVE 327, FAD/NAD...		Lus10010776 [exp]	5.3	0.9312
					Lus10021760 [exp]	7.7	0.7867
AT5G40900			Nucleotide-diphospho-sugar tra...		Lus10032050 [exp]	8.9	0.8793
AT1G63690		ATSPPL2	SIGNAL PEPTIDE PEPTIDASE-LIKE ...		Lus10035485 [exp]	9.7	0.7896

Compare expression of checked genes

Lus10008700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.