Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40070 47 / 3e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040188 [exp] 92 / 9e-23 AT2G40070 533 / 0.0 unknown protein Lus10040317 [exp] 82 / 2e-21 AT5G01140 39 / 1e-04 Protein of unknown function (DUF674) (.1) Lus10030402 [exp] 67 / 3e-14 AT2G40070 561 / 0.0 unknown protein Lus10027810 [exp] 64 / 5e-14 AT5G05570 84 / 2e-19 transducin family protein / WD-40 repeat family protein (.1.2) Lus10037838 [exp] 64 / 4e-13 AT2G40070 551 / 0.0 unknown protein Lus10003163 [exp] 55 / 4e-10 AT3G09110 100 / 2e-24 Protein of unknown function (DUF674) (.1) Lus10003167 [exp] 52 / 6e-09 AT3G09140 100 / 5e-25 Protein of unknown function (DUF674) (.1), Protein of unknown function (DUF674) (.2) Lus10003164 [exp] 51 / 1e-08 AT5G01130 95 / 6e-23 Protein of unknown function (DUF674) (.1) Lus10003166 [exp] 47 / 3e-07 AT3G09110 104 / 3e-26 Protein of unknown function (DUF674) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G190300 [exp] 69 / 9e-15 AT2G40070 368 / 6e-121 unknown protein Potri.008G066900 [exp] 66 / 8e-14 AT2G40070 321 / 1e-102 unknown protein Potri.008G050100 [exp] 58 / 2e-11 ND / Potri.008G050000 [exp] 56 / 2e-10 AT3G09110 94 / 1e-22 Protein of unknown function (DUF674) (.1) Potri.010G210500 [exp] 56 / 2e-10 AT3G09110 73 / 4e-15 Protein of unknown function (DUF674) (.1) Potri.010G210400 [exp] 55 / 2e-10 ND / Potri.010G210800 [exp] 54 / 7e-10 AT3G09110 86 / 2e-19 Protein of unknown function (DUF674) (.1) Potri.010G210600 [exp] 39 / 0.0001 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05056 [flax] [poplar] DUF674 Protein of unknown function (DUF674)
Representative CDS sequence Show only first row Show all	>Lus10008717 pacid=23161947 polypeptide=Lus10008717 locus=Lus10008717.g ID=Lus10008717.BGIv1.0 annot-version=v1.0 ATGCAAGCGACGATAGCCAAACAGAGGCAGCAGTTGAGAGCCTCCATGATGAAGGACAAGGAAGAGGGGCTTGCCTTGTTCTTGGAGATGAAGAAGCGCG AGAACGAGCTGCGGCAGCAGCAGGAGCCTGATCTCCTTCAGCTTAATGAGACTGCCGAATTTGATGTTTCTTTCATGGTGATGGATGATCTGAGAGTGAA TCAATTGTCCATGATCTCTGCTCTTACTTTGCTCAACAAATTCGGTTGTAAGGATCTTGGTGCCCTGGACGAGATTGAGGCTGAGTTTGGAATCGATGAG GGCAGATGGAGCAATTGGGGAAGATAG
AA sequence Show only first row Show all	>Lus10008717 pacid=23161947 polypeptide=Lus10008717 locus=Lus10008717.g ID=Lus10008717.BGIv1.0 annot-version=v1.0 MQATIAKQRQQLRASMMKDKEEGLALFLEMKKRENELRQQQEPDLLQLNETAEFDVSFMVMDDLRVNQLSMISALTLLNKFGCKDLGALDEIEAEFGIDE GRWSNWGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40070			unknown protein		Lus10008717 [exp]	0	1
					Lus10002449 [exp]	2.4	1.0000
AT5G42800		M318, TT3, DFR	dihydroflavonol 4-reductase (....		Lus10006195 [exp]	4.2	1.0000
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	4.8	1.0000
AT5G19580			glyoxal oxidase-related protei...		Lus10011111 [exp]	5.2	1.0000
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Lus10002972 [exp]	5.5	1.0000
AT1G14220			Ribonuclease T2 family protein...		Lus10015409 [exp]	6.2	1.0000
AT5G12460			Protein of unknown function (D...		Lus10003179 [exp]	6.6	1.0000
					Lus10003763 [exp]	7.4	1.0000
AT1G76250			unknown protein		Lus10008273 [exp]	7.5	1.0000
					Lus10009191 [exp]	7.7	1.0000

Compare expression of checked genes

Lus10008717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.