Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27060 104 / 4e-26 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G11580 69 / 1e-13 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G23270 56 / 4e-09 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G76950 55 / 1e-08 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 54 / 3e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G12350 54 / 3e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G63860 53 / 3e-08 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G60870 52 / 5e-08 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT5G42140 52 / 1e-07 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT4G14368 51 / 3e-07 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012474 [exp] 326 / 5e-115 AT1G27060 89 / 2e-21 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10038724 [exp] 211 / 4e-65 AT5G11580 629 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10024239 [exp] 195 / 8e-62 AT1G26930 147 / 3e-41 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10010038 [exp] 162 / 5e-51 AT1G27060 134 / 1e-38 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10037219 [exp] 146 / 1e-41 AT1G27060 424 / 1e-147 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10036707 [exp] 136 / 4e-38 AT1G27060 375 / 1e-128 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10026455 [exp] 83 / 4e-20 AT3G51770 63 / 2e-12 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10039525 [exp] 57 / 3e-09 AT5G19420 1245 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10016335 [exp] 56 / 7e-09 AT5G19420 971 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G107000 [exp] 117 / 9e-31 AT1G27060 446 / 1e-156 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.018G044400 [exp] 115 / 1e-29 AT5G11580 578 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G026900 [exp] 56 / 5e-09 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.005G190000 [exp] 56 / 6e-09 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.009G071800 [exp] 56 / 7e-09 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.001G276900 [exp] 55 / 1e-08 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.008G167500 [exp] 55 / 1e-08 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.T124906 [exp] 54 / 2e-08 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.003G197600 [exp] 54 / 2e-08 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.002G026600 [exp] 52 / 9e-08 AT1G19880 703 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10008730 pacid=23169028 polypeptide=Lus10008730 locus=Lus10008730.g ID=Lus10008730.BGIv1.0 annot-version=v1.0 ATGGATGAAGAAGACGAGAGAAGCGAAGAACAGGAACAAATCTGGAGCTGGGGAGCTAGAAAACACGGACAACTCGGAACTGGGAAGCTGGAGGATGAGC TCCTCCCTAAGCTCCTCCGTCCTCCGCCGCTCACCGCCGCCGGACTAATCTCCATGCTCGCCTGCGGCGGAGCTCACGTTATTGCTTTGACGACAGGTGG AAGAGTACTAACATGGGGAAGAGGCGCATCTGGCCAGCTCGGCCATGGAGATACGTTGACCTGCTTAGAGCCAAAGATTGTGGAGTCTTTGAAGAATTAT ATAATAGTAACTCACGTCTCTGCTGGATGGAGCCACTATGGATTTGTTCTTGGAAATGAAAAGATTATTGATTTTTATGCCCCTAGTCATGTGTTATGGC CTCCACTAGTTGAGGATTCCAAGGAACAACAGCTCGGTGATGTTAATGAAAAGGATGAAGTTAGAGACGAGGGTTCTGATAATGACAAAAGACTATCAGC TGCAATGGACGAGATGAAGCTTCTCCGATCTAAATATTCATCGATGGAGCAACACGCTAACATGCTTCATGGTCTTATTTTTGGTCAACGTTTAAGGGAA CATAAAATTACTAGCTCCTGGCAACAGTCAAGTGGTGTTCATATCGCAAGACAATGGGAAGACATGTTAGAATCAGTTTGA
AA sequence Show only first row Show all	>Lus10008730 pacid=23169028 polypeptide=Lus10008730 locus=Lus10008730.g ID=Lus10008730.BGIv1.0 annot-version=v1.0 MDEEDERSEEQEQIWSWGARKHGQLGTGKLEDELLPKLLRPPPLTAAGLISMLACGGAHVIALTTGGRVLTWGRGASGQLGHGDTLTCLEPKIVESLKNY IIVTHVSAGWSHYGFVLGNEKIIDFYAPSHVLWPPLVEDSKEQQLGDVNEKDEVRDEGSDNDKRLSAAMDEMKLLRSKYSSMEQHANMLHGLIFGQRLRE HKITSSWQQSSGVHIARQWEDMLESV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27060			Regulator of chromosome conden...		Lus10008730 [exp]	0	1
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Lus10038862 [exp]	10.5	0.5059
AT1G75340	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10028100 [exp]	25.2	0.4995
AT4G12290			Copper amine oxidase family pr...		Lus10024571 [exp]	207.2	0.3565

Compare expression of checked genes

Lus10008730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.