Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17165 71 / 7e-17 unknown protein AT3G03150 66 / 1e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002135 [exp] 168 / 3e-55 AT5G17165 68 / 9e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G081700 [exp] 67 / 3e-15 AT5G17165 125 / 3e-38 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008759 pacid=23169029 polypeptide=Lus10008759 locus=Lus10008759.g ID=Lus10008759.BGIv1.0 annot-version=v1.0 ATGGCCGCCAATTGCAGCAGAGGAATAGCGAGCGTCGGCAAGCGAGTCATCGGCCATCGCATCCCCAACTCCTCCCCCGCAATTGCTCCTATTCCCACTC CCTGGCGTGGATTGGTGCATACGTCGGCCTATGAGAAGAACATAGAGGCCGTTACGACAGGGGAGGATGATGGTATATTCCAGCAGGCGACTCAGCAGCT GAATCCCCCCGGGCAGAAAGACAGCAAGTACCATTATTGGGAGCCACACCCGCAGACTGGGGTGTTTGGCCCCGCTTCTGCTGCTTCATCGGGGGCCAAG TGTACTACTACTATCACTGATGCACCAGAGGAGAAGGCCTGGTTCCGCCCTACAAGTCTTGAGGACTTGGAGAAGCCCCATCCTCTTCCTTAA
AA sequence Show only first row Show all	>Lus10008759 pacid=23169029 polypeptide=Lus10008759 locus=Lus10008759.g ID=Lus10008759.BGIv1.0 annot-version=v1.0 MAANCSRGIASVGKRVIGHRIPNSSPAIAPIPTPWRGLVHTSAYEKNIEAVTTGEDDGIFQQATQQLNPPGQKDSKYHYWEPHPQTGVFGPASAASSGAK CTTTITDAPEEKAWFRPTSLEDLEKPHPLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03150			unknown protein		Lus10008759 [exp]	0	1
AT2G28100		ATFUC1	alpha-L-fucosidase 1 (.1)		Lus10027390 [exp]	6.5	0.7877
AT5G24090		ATCHIA	chitinase A (.1)		Lus10040420 [exp]	8.4	0.8089
AT3G60460	MYB	DUO1	DUO POLLEN 1, myb-like HTH tra...		Lus10009780 [exp]	9.0	0.8115
AT5G65550			UDP-Glycosyltransferase superf...		Lus10008956 [exp]	11.1	0.8070
AT1G69800			Cystathionine beta-synthase (C...		Lus10013265 [exp]	12.8	0.7880
AT1G66930			Protein kinase superfamily pro...		Lus10008362 [exp]	14.6	0.8048
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10040063 [exp]	16.5	0.7817
					Lus10020900 [exp]	19.2	0.7727
AT1G69800			Cystathionine beta-synthase (C...		Lus10030788 [exp]	22.4	0.7700
					Lus10011017 [exp]	22.6	0.7629

Compare expression of checked genes

Lus10008759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.