Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40382 92 / 8e-27 Cytochrome c oxidase subunit Vc family protein (.1) AT5G61310 86 / 4e-24 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) AT2G47380 66 / 3e-16 Cytochrome c oxidase subunit Vc family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022249 [exp] 106 / 2e-32 AT5G40382 91 / 3e-26 Cytochrome c oxidase subunit Vc family protein (.1) Lus10002429 [exp] 82 / 2e-22 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10010008 [exp] 82 / 2e-22 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10001454 [exp] 82 / 2e-22 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10025028 [exp] 78 / 3e-21 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10040012 [exp] 78 / 5e-21 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195901 [exp] 85 / 6e-24 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Potri.014G120500 [exp] 82 / 1e-22 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10008765 pacid=23177845 polypeptide=Lus10008765 locus=Lus10008765.g ID=Lus10008765.BGIv1.0 annot-version=v1.0 ATGGCTGCACACGTTGTATACAAAGGTCCGAGCATCATTAAAGAGATTGTGTATGGCGTCTCTCTAGGATTGGCTGCTGGCTTCCTCTGGAAAATACACC ACTGGAACAACCAGAAACGAACCAGAGAGTTCTATGATCTCCTTGACAAAGGAGTCATCAGCGTCGTCGTTGTCCATGAAGAAGACGATCATTAA
AA sequence Show only first row Show all	>Lus10008765 pacid=23177845 polypeptide=Lus10008765 locus=Lus10008765.g ID=Lus10008765.BGIv1.0 annot-version=v1.0 MAAHVVYKGPSIIKEIVYGVSLGLAAGFLWKIHHWNNQKRTREFYDLLDKGVISVVVVHEEDDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40382			Cytochrome c oxidase subunit V...		Lus10008765 [exp]	0	1
AT2G46630			unknown protein		Lus10005994 [exp]	2.2	0.9122
AT1G59970			Matrixin family protein (.1)		Lus10030662 [exp]	4.2	0.8670
AT3G22550			Protein of unknown function (D...		Lus10010568 [exp]	5.3	0.8774
AT3G60690			SAUR-like auxin-responsive pro...		Lus10009286 [exp]	7.7	0.8796
AT2G46630			unknown protein		Lus10030217 [exp]	8.4	0.8941
AT2G39450		ATMTP11	Cation efflux family protein (...		Lus10040318 [exp]	12.1	0.8656
AT2G23200			Protein kinase superfamily pro...		Lus10012101 [exp]	14.7	0.8319
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10018915 [exp]	14.7	0.8718
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10031230 [exp]	17.5	0.8411
AT5G58900	MYB		Homeodomain-like transcription...		Lus10040696 [exp]	17.9	0.8002

Compare expression of checked genes

Lus10008765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.