Lus10008771 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40390 338 / 3e-112 RS5, SIP1 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
AT4G01970 227 / 2e-69 RS4, ATSTS raffinose synthase 4, stachyose synthase (.1)
AT5G20250 179 / 3e-52 RS6, DIN10 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
AT3G57520 172 / 2e-50 RS2, ATSIP2 raffinose synthase 2, seed imbibition 2 (.1.2.3)
AT1G55740 162 / 4e-46 RS1, ATSIP1 raffinose synthase 1, seed imbibition 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022240 411 / 2e-144 AT5G40390 744 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10027679 332 / 1e-109 AT5G40390 1040 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10017516 173 / 4e-50 AT5G20250 1145 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Lus10007537 165 / 4e-47 AT3G57520 1235 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Lus10039945 0 / 1 AT5G40390 164 / 8e-58 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G123400 365 / 1e-122 AT5G40390 1147 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.004G207900 362 / 1e-121 AT5G40390 1145 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.017G036700 360 / 1e-120 AT5G40390 1118 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.T124908 334 / 1e-110 AT5G40390 1055 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.014G118400 244 / 6e-76 AT4G01970 1087 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.002G193700 242 / 6e-75 AT4G01970 1040 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.018G126400 176 / 4e-51 AT5G20250 1218 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.006G065700 173 / 5e-50 AT5G20250 1154 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.011G166700 168 / 3e-48 AT1G55740 1154 / 0.0 raffinose synthase 1, seed imbibition 1 (.1)
Potri.016G002300 161 / 8e-46 AT3G57520 758 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1
Representative CDS sequence
>Lus10008771 pacid=23177848 polypeptide=Lus10008771 locus=Lus10008771.g ID=Lus10008771.BGIv1.0 annot-version=v1.0
ATGCCTTCAGGGAATGGGGTAATTGCTAGCATGGAGCACTGCAACGATTTCATGTTCCTTGGTACAGAAGCCATAACTCTTGGCCGTGTTGTGGTGGAAG
GAACTAAATGTTTTTGGGATTGGGTTCTGGTTGGGCTCCCAGGTGGTGATTTCTGGTGTACCGATCCATCTCGAGATCCAAACGGCACATTTTGGCTCCA
GGGATGTCATATGGTTCACTGTGCTTACAACAGCTTGTGGATAGGCAATTTCATCCACCCTGACTGGGACATGTTCCAGTCAACTCACCCTTATGCTGAG
TTCCACGTTGCTTCTCATGCTATCTCAGGAGGCCCAATTTACATTAGTGACACCATCGGGAAACACAATATCCCATTGCTGAAGCGTCTAGCGCTGCCTG
ATGGTTCTATTCTCCGTTGTGAGTACTATGCACTTCCCACCAGGGACTGCCTATTTGAGGATCCCCTCCATGATGGCAAGACCATGCTCAAAATTTGGAA
CCTCAACAAGTTTACTGGAGTTATCGGAGCGTTCAACTGCCAAGGTGGAGAATGGTCCAGAGAAACAAGACGCAACCAATGTGCCTCTCAGTTCTCTCAC
AGGGTCACTGCCAAAACCAACCCATATGACATTGAGTGA
AA sequence
>Lus10008771 pacid=23177848 polypeptide=Lus10008771 locus=Lus10008771.g ID=Lus10008771.BGIv1.0 annot-version=v1.0
MPSGNGVIASMEHCNDFMFLGTEAITLGRVVVEGTKCFWDWVLVGLPGGDFWCTDPSRDPNGTFWLQGCHMVHCAYNSLWIGNFIHPDWDMFQSTHPYAE
FHVASHAISGGPIYISDTIGKHNIPLLKRLALPDGSILRCEYYALPTRDCLFEDPLHDGKTMLKIWNLNKFTGVIGAFNCQGGEWSRETRRNQCASQFSH
RVTAKTNPYDIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10008771 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10012041 11.4 0.9026
AT3G06390 Uncharacterised protein family... Lus10012808 12.6 0.9036
AT1G10600 AMSH2 associated molecule with the S... Lus10030613 13.3 0.9116
AT5G23750 Remorin family protein (.1.2) Lus10001477 19.5 0.9052
AT5G07440 GDH2 glutamate dehydrogenase 2 (.1.... Lus10043007 20.2 0.9087
AT4G12840 Protein of unknown function (D... Lus10041107 21.0 0.9034
AT4G33950 ATOST1, P44, SR... SNF1-RELATED PROTEIN KINASE 2.... Lus10027931 29.0 0.9057
AT2G45720 ARM repeat superfamily protein... Lus10036559 29.7 0.9038
AT1G07110 FKFBP, ATF2KP, ... "fructose-2,6-bisphosphatase",... Lus10042278 29.7 0.8862
AT1G72460 Leucine-rich repeat protein ki... Lus10008128 30.2 0.8666

Lus10008771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.