Lus10008772 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14680 190 / 1e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G01520 178 / 7e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G58450 58 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G11930 50 / 2e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
AT1G09740 47 / 2e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G62550 46 / 3e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G68300 45 / 7e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03270 42 / 6e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G17020 40 / 0.0004 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014545 204 / 4e-67 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10032142 203 / 2e-66 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10034337 49 / 5e-07 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029310 48 / 1e-06 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Lus10041436 47 / 1e-06 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10009272 43 / 5e-05 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10006701 43 / 6e-05 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10007043 40 / 0.0005 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G071700 184 / 4e-59 AT5G14680 298 / 6e-105 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.008G121900 63 / 2e-12 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.016G064000 58 / 2e-10 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.010G123200 56 / 9e-10 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.008G121800 53 / 1e-08 AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G123400 51 / 6e-08 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.006G198200 51 / 7e-08 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.008G221300 50 / 2e-07 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G015200 49 / 3e-07 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G144100 49 / 4e-07 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10008772 pacid=23177869 polypeptide=Lus10008772 locus=Lus10008772.g ID=Lus10008772.BGIv1.0 annot-version=v1.0
ATGGGGAGTGAACTGATCAAGTATGAAATCACAGTTCCCGCGTTGTTGCTACTTGCCGAGACTTGTCTGAAGAGCAAGAGAGGGAGGCGAGATTTGAGTG
GCGAAGGAAACCACATGAAGATGGAAGAAGAGCATCCTCCTACTCGGATATTGATAGCGGTGAACGAGGCAACAGTGATGAGCAACAACCCACATCCTTC
CATTAGTTGCAGAGGTGCATTCGAGTGGACTCTCGACCACATTGTTCGTTCCAACTTTTCTGGATTCAGCCTTCTCTTCCTTAACGTTCAACCCACCTAC
GAACAAGGTTTTGAAGGCATGATGGATGGGATATACACATGTCCAGATGATTTCAGGCAGTTGGCTAGCAGAAACAAGGCTAGATCTGTTCAGCTGCTGG
AGTACTTTGTTGATAGATGCCATGCACTTGGGATTGCTTGTGAGGCGTGGATTAAGATGGGTGATCCAACAGTAGAGATATGTGGTGAGGCGAGACGAGT
GCAGCCAGACTTTGTTGTTGTTGGGAGCAGGAGACACGCATCTTACAGGAGGGCAGCGTTGGAATCTGTGAGTGATCATGTTGAGAAATATAAAGAGTGC
CATGTGATTGTCATCACTCGCAATGCTCATGAAGCCACCAGAGGATCCAGTTCCAGACTGACCGACTCCATGTGA
AA sequence
>Lus10008772 pacid=23177869 polypeptide=Lus10008772 locus=Lus10008772.g ID=Lus10008772.BGIv1.0 annot-version=v1.0
MGSELIKYEITVPALLLLAETCLKSKRGRRDLSGEGNHMKMEEEHPPTRILIAVNEATVMSNNPHPSISCRGAFEWTLDHIVRSNFSGFSLLFLNVQPTY
EQGFEGMMDGIYTCPDDFRQLASRNKARSVQLLEYFVDRCHALGIACEAWIKMGDPTVEICGEARRVQPDFVVVGSRRHASYRRAALESVSDHVEKYKEC
HVIVITRNAHEATRGSSSRLTDSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14680 Adenine nucleotide alpha hydro... Lus10008772 0 1
AT2G36710 Pectin lyase-like superfamily ... Lus10027737 3.7 0.7958
AT2G36220 unknown protein Lus10022709 6.2 0.7769
Lus10009493 16.7 0.7359
AT5G62690 TUB2 tubulin beta chain 2 (.1) Lus10002000 22.0 0.7457
AT3G23050 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-ac... Lus10002724 25.9 0.7531
AT5G01460 LMBR1-like membrane protein (.... Lus10027794 29.2 0.7415
AT5G66920 SKS17 SKU5 similar 17 (.1) Lus10016770 39.0 0.7311
AT1G05170 Galactosyltransferase family p... Lus10015107 50.3 0.7140
AT4G18710 DWF12, UCU1, BI... ULTRACURVATA 1, DWARF 12, BRAS... Lus10025395 54.9 0.7131
AT5G35570 O-fucosyltransferase family pr... Lus10021557 62.4 0.7171

Lus10008772 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.