Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008773 pacid=23177843 polypeptide=Lus10008773 locus=Lus10008773.g ID=Lus10008773.BGIv1.0 annot-version=v1.0 ATGGGTGGGTGGTCGATGCGAGGAACAATTGGAAGACCTGAAGGGATTAGCTCGAGTCAGCAACTATGGCAGACGACCGACCACATAGTGATGATGAACG TGCAGTTCTACCCAATGAAGACATCGAAGATGAACCAATCCTCTTCGAGCAAGGTGATATTCAGGAATCAGAGGAACGGGTTCATCGAAGCTTAA
AA sequence Show only first row Show all	>Lus10008773 pacid=23177843 polypeptide=Lus10008773 locus=Lus10008773.g ID=Lus10008773.BGIv1.0 annot-version=v1.0 MGGWSMRGTIGRPEGISSSQQLWQTTDHIVMMNVQFYPMKTSKMNQSSSSKVIFRNQRNGFIEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008773 [exp]	0	1
AT5G52975			Protein of unknown function (D...		Lus10027141 [exp]	7.1	0.6357
AT5G07050			nodulin MtN21 /EamA-like trans...		Lus10008708 [exp]	12.9	0.6276
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Lus10007113 [exp]	22.3	0.5802
AT4G32630			ArfGap/RecO-like zinc finger d...		Lus10022113 [exp]	28.5	0.5952
AT5G56610			Phosphotyrosine protein phosph...		Lus10034998 [exp]	30.9	0.5766
AT3G56970	bHLH	ORG2, bHLH038	OBP3-RESPONSIVE GENE 3, basic ...		Lus10010453 [exp]	45.8	0.5748
					Lus10003285 [exp]	49.7	0.5688
					Lus10000363 [exp]	52.1	0.5688
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10027745 [exp]	54.4	0.5688
					Lus10039545 [exp]	56.7	0.5688

Compare expression of checked genes

Lus10008773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.