Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27870 130 / 5e-36 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT3G25610 103 / 9e-27 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G13210 100 / 1e-25 ACA.L autoinhibited Ca2+/ATPase II, autoinhibited Ca2+/ATPase II (.1) AT1G26130 87 / 9e-21 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1.2) AT1G17500 85 / 3e-20 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G68710 81 / 1e-18 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G72700 78 / 8e-18 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT3G13900 77 / 2e-17 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G54280 72 / 8e-16 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT5G44240 40 / 0.0001 ALA2 aminophospholipid ATPase 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022238 [exp] 204 / 4e-62 AT3G27870 1837 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10035069 [exp] 100 / 3e-25 AT3G25610 1783 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10034404 [exp] 96 / 5e-24 AT3G25610 969 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10019152 [exp] 96 / 5e-24 AT3G25610 1871 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10035068 [exp] 94 / 3e-23 AT1G68710 1677 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10006017 [exp] 91 / 5e-22 AT1G17500 1851 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10008473 [exp] 91 / 5e-22 AT1G17500 1914 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10037622 [exp] 86 / 2e-20 AT1G17500 1895 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10006881 [exp] 86 / 2e-20 AT1G17500 1907 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G349100 [exp] 121 / 6e-33 AT3G27870 1687 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.012G058000 [exp] 107 / 5e-28 AT1G68710 1764 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.001G197500 [exp] 89 / 2e-21 AT1G17500 1902 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.003G043300 [exp] 87 / 7e-21 AT1G17500 1891 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.001G081200 [exp] 73 / 6e-16 AT1G17500 1461 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.008G111200 [exp] 68 / 3e-14 AT1G68710 1767 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.010G132700 [exp] 62 / 4e-12 AT1G68710 1753 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008777 pacid=23177866 polypeptide=Lus10008777 locus=Lus10008777.g ID=Lus10008777.BGIv1.0 annot-version=v1.0 ATGGCACTCTCCATCAATTACTTCACTTGGATTCAGCACTTCTTCATCTGGGGAAGCATAGCATTCTGGTACATATTTCTCTTGATCTACGGCTACATTG ACCCAACAATATCCACAACAGCTTACATGGTGCTCATAGAAGCTTGCATCCCAAGTCCTCTCTATTGGCTCGTCACTCTTCTCGTTGTGGTGTCTGCTCT GCTGCCTTGCTTTGCGAACCGAGCCTTCCAGTCCAGATTCCGGCCAATGTACCATGACATTATACAGATACGGAGAGCAGAAGGGTCGGAGATTGAAACT TCTTCCGGTTCAGGCGAGTTGCCTACCGACGTTAAGTTAAGAGTGCATCATCTCAAGGAAGGGTTGATGCAGAGGAACTCGTAA
AA sequence Show only first row Show all	>Lus10008777 pacid=23177866 polypeptide=Lus10008777 locus=Lus10008777.g ID=Lus10008777.BGIv1.0 annot-version=v1.0 MALSINYFTWIQHFFIWGSIAFWYIFLLIYGYIDPTISTTAYMVLIEACIPSPLYWLVTLLVVVSALLPCFANRAFQSRFRPMYHDIIQIRRAEGSEIET SSGSGELPTDVKLRVHHLKEGLMQRNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27870			ATPase E1-E2 type family prote...		Lus10008777 [exp]	0	1
AT5G41240		GST10B, ATGSTT2	glutathione S-transferase THET...		Lus10000606 [exp]	1.7	0.9061
AT2G37570		SLT1	sodium- and lithium-tolerant 1...		Lus10025337 [exp]	14.8	0.8658
AT4G38360		LAZ1	LAZARUS 1, Protein of unknown ...		Lus10022626 [exp]	15.9	0.8715
AT5G46060			Protein of unknown function, D...		Lus10005267 [exp]	21.7	0.8347
AT3G09760			RING/U-box superfamily protein...		Lus10019931 [exp]	21.8	0.8714
AT5G58050		GDPDL6, SVL4	Glycerophosphodiester phosphod...		Lus10000055 [exp]	28.1	0.8387
AT4G28830			S-adenosyl-L-methionine-depend...		Lus10011107 [exp]	36.6	0.8678
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10028538 [exp]	36.9	0.8524
AT4G32160			Phox (PX) domain-containing pr...		Lus10001496 [exp]	50.3	0.8663
AT5G08560			transducin family protein / WD...		Lus10001411 [exp]	51.0	0.8552

Compare expression of checked genes

Lus10008777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.