Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11090 54 / 7e-10 serine-rich protein-related (.1) AT5G25280 50 / 2e-08 serine-rich protein-related (.1.2) AT5G20370 40 / 5e-05 serine-rich protein-related (.1) AT1G67910 39 / 7e-05 unknown protein AT3G56500 39 / 8e-05 serine-rich protein-related (.1) AT1G24577 37 / 0.0001 unknown protein AT3G13227 38 / 0.0002 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038101 [exp] 96 / 9e-27 AT5G11090 54 / 2e-09 serine-rich protein-related (.1) Lus10039998 [exp] 58 / 2e-11 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10008808 [exp] 58 / 2e-11 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10006660 [exp] 54 / 6e-10 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2) Lus10001946 [exp] 54 / 7e-10 AT5G11090 179 / 9e-57 serine-rich protein-related (.1) Lus10038100 [exp] 54 / 8e-10 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2) Lus10001928 [exp] 52 / 4e-09 AT5G11090 177 / 3e-56 serine-rich protein-related (.1) Lus10034901 [exp] 40 / 2e-05 AT1G67910 49 / 6e-09 unknown protein Lus10023632 [exp] 40 / 3e-05 AT1G67910 48 / 1e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G120300 [exp] 72 / 6e-18 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.006G060700 [exp] 72 / 9e-18 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.006G060800 [exp] 52 / 3e-09 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2) Potri.018G023300 [exp] 50 / 2e-08 AT5G11090 194 / 1e-62 serine-rich protein-related (.1) Potri.018G120400 [exp] 47 / 2e-07 AT5G11090 126 / 3e-36 serine-rich protein-related (.1) Potri.006G258600 [exp] 45 / 1e-06 AT5G25280 181 / 1e-57 serine-rich protein-related (.1.2) Potri.002G250700 [exp] 39 / 0.0001 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.008G186200 [exp] 38 / 0.0001 AT1G67910 85 / 4e-23 unknown protein Potri.010G046700 [exp] 38 / 0.0002 AT1G67910 82 / 4e-22 unknown protein Potri.018G079200 [exp] 36 / 0.0005 AT1G67910 45 / 9e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008811 pacid=23151880 polypeptide=Lus10008811 locus=Lus10008811.g ID=Lus10008811.BGIv1.0 annot-version=v1.0 ATGGATACTGCAATTCCTCTTCTCCCCTCATCTCCAAGAAAGAGTCGGACGTGTCTCTGCTCTCCGACCAACCATCCGGGCTCCTTCCGTTGCGTCCTCC ACAAGAACAAACTGTCCCGCCGGCGGGAATCGTCTTCGGCGGCGGCCAAGGCGTTTACGTTGAGAGCTTTTCTGATGCAGATCATCAATCCTTCCACGAG CGATGTCAAGCGGCGGAGGAATTTCCAGCCAAGGCCGTCCAGGTTTTGCCAGATGAGCGGTAGTAACGGCGGGGGCGGTGGCGTTGCCGTTTCTTGA
AA sequence Show only first row Show all	>Lus10008811 pacid=23151880 polypeptide=Lus10008811 locus=Lus10008811.g ID=Lus10008811.BGIv1.0 annot-version=v1.0 MDTAIPLLPSSPRKSRTCLCSPTNHPGSFRCVLHKNKLSRRRESSSAAAKAFTLRAFLMQIINPSTSDVKRRRNFQPRPSRFCQMSGSNGGGGGVAVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11090			serine-rich protein-related (....		Lus10008811 [exp]	0	1
AT1G09600			Protein kinase superfamily pro...		Lus10000170 [exp]	13.0	0.6747
AT5G59700			Protein kinase superfamily pro...		Lus10020474 [exp]	17.9	0.6456
AT4G33985			Protein of unknown function (D...		Lus10014064 [exp]	22.4	0.6227
AT5G36930			Disease resistance protein (TI...		Lus10025497 [exp]	24.3	0.5932
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10008976 [exp]	25.0	0.6092
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10041630 [exp]	28.5	0.6092
AT1G68050		ADO3, FKF1	"flavin-binding, kelch repeat,...		Lus10029002 [exp]	48.6	0.5692
					Lus10021874 [exp]	48.6	0.5537
AT1G13890		ATSNAP30, SNAP3...	soluble N-ethylmaleimide-sensi...		Lus10004660 [exp]	87.4	0.5535
AT5G40960			Protein of unknown function (D...		Lus10012541 [exp]	90.8	0.5329

Compare expression of checked genes

Lus10008811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.