Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038105 [exp] 54 / 1e-10 ND / Lus10008034 [exp] 46 / 2e-07 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G059900 [exp] 49 / 1e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008816 pacid=23151883 polypeptide=Lus10008816 locus=Lus10008816.g ID=Lus10008816.BGIv1.0 annot-version=v1.0 ATGAAGGCATTGTTGGTCGTTTTTCTTCTACTCGCCTGCTTCCTCCTCCGACCAACTCAAGGGATCCGGCTGGAGAAGGGATTTGGTGAACAACAAAGAG AAGAGATGATGAAGAGGAAGCAGAAGAGCTCTTCATTATTAATGAATGAAAGTAGTGAAGATAAGCTCATTCAGAATAGTAATGGTGGAGTAGCTGTTTG CAAACAAGGGGAACAGTGTGATATTAAAGGTATTGATGAGATGAAGACAACAACATCATCTTCATATCATTGGCTTCATGAAGATTACAAAGGACCTAAG CATCATAGACCTATGCACCATTAA
AA sequence Show only first row Show all	>Lus10008816 pacid=23151883 polypeptide=Lus10008816 locus=Lus10008816.g ID=Lus10008816.BGIv1.0 annot-version=v1.0 MKALLVVFLLLACFLLRPTQGIRLEKGFGEQQREEMMKRKQKSSSLLMNESSEDKLIQNSNGGVAVCKQGEQCDIKGIDEMKTTTSSSYHWLHEDYKGPK HHRPMHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008816 [exp]	0	1
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10000279 [exp]	1.4	0.9883
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10019637 [exp]	2.0	0.9871
					Lus10010481 [exp]	2.4	0.9826
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10007362 [exp]	2.4	0.9760
AT5G43745			Protein of unknown function (D...		Lus10039407 [exp]	4.0	0.9538
AT1G14960			Polyketide cyclase/dehydrase a...		Lus10042489 [exp]	4.5	0.9787
AT1G62940		ACOS5	acyl-CoA synthetase 5 (.1)		Lus10025842 [exp]	5.1	0.9444
					Lus10002266 [exp]	5.1	0.9622
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10015169 [exp]	5.7	0.9739
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10030480 [exp]	5.9	0.9749

Compare expression of checked genes

Lus10008816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.