Lus10008820 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G11890 197 / 2e-63 adenylate cyclases (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024472 200 / 2e-64 AT2G11890 189 / 2e-60 adenylate cyclases (.1.2)
Lus10002992 194 / 5e-62 AT2G11890 190 / 7e-61 adenylate cyclases (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G121300 255 / 1e-86 AT2G11890 218 / 1e-72 adenylate cyclases (.1.2)
Potri.006G062000 248 / 1e-83 AT2G11890 212 / 8e-70 adenylate cyclases (.1.2)
Potri.003G198200 204 / 1e-66 AT2G11890 176 / 1e-55 adenylate cyclases (.1.2)
Potri.T125606 204 / 1e-66 AT2G11890 175 / 1e-55 adenylate cyclases (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0273 CYTH PF01928 CYTH CYTH domain
Representative CDS sequence
>Lus10008820 pacid=23151878 polypeptide=Lus10008820 locus=Lus10008820.g ID=Lus10008820.BGIv1.0 annot-version=v1.0
ATGCTGAGAAGGAAACCCACCAAAATCGAAGTGACAATCGACGACAAAGACGAACTCGAAGAAGCCCGCCGACGATCCGCCGCCGCCGCTGCCGCTGCCG
CTGCCACTACAACTAACACCTCTGCAGCCTCTTTCCTTGCTCACCTACGATTCAAAACCCTAATTTCCCAATCCCACTTGAAAACAGTCAACCAGCACAA
CCTATTCTTCGACACTCCCACCTCCGCCTTATCCACCAAGCGAGCTGTTCTTCGTCTCCGATTCCTTGACGATACCCGCTGTGTCGTTTCTCTCAAGGCG
AAGGCCGTTCTAGTTAACGGGGTGAGTCGGGTCGAGGAAGACGAGGAGGAGATCGACCCCGGTATGGGTCGAGCGTGCGCTGATGACCCGACGAAGCTGG
GATCGATTGATTCGAGGATTGTGAGGCGGTGTAAGGATGAGTTTGGGGAGGGGAAAAGCGAGATTGAGTTCGTTTGTTTGGGAGGGTTTGAGAATGTGAG
GGATGTTTATGATTGGAGAGGGTTTGTGTTGGAAGTGGACGAGACTAAGTATGCGTTTGGGGTCTGCTATGAGATTGAGTGTGAAAGTGAGGATCCTGAG
AGGGTTAAGAAGGAGCTTGAGGAGTTTCTGAAAGAGAATGGGATTGACTATAAGTACTCTCTGGTGTCCAAGTTTGCCGCTTTTCGATCTGGAAAGCTTC
CATCCTAG
AA sequence
>Lus10008820 pacid=23151878 polypeptide=Lus10008820 locus=Lus10008820.g ID=Lus10008820.BGIv1.0 annot-version=v1.0
MLRRKPTKIEVTIDDKDELEEARRRSAAAAAAAAATTTNTSAASFLAHLRFKTLISQSHLKTVNQHNLFFDTPTSALSTKRAVLRLRFLDDTRCVVSLKA
KAVLVNGVSRVEEDEEEIDPGMGRACADDPTKLGSIDSRIVRRCKDEFGEGKSEIEFVCLGGFENVRDVYDWRGFVLEVDETKYAFGVCYEIECESEDPE
RVKKELEEFLKENGIDYKYSLVSKFAAFRSGKLPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G11890 adenylate cyclases (.1.2) Lus10008820 0 1
AT5G08680 ATP synthase alpha/beta family... Lus10034631 3.0 0.9654
AT1G70780 unknown protein Lus10019143 5.3 0.9377
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021051 5.5 0.9527
AT5G48930 HCT hydroxycinnamoyl-CoA shikimate... Lus10010786 7.7 0.9471
AT1G72330 ALAAT2 alanine aminotransferase 2 (.1... Lus10003935 7.9 0.9517
AT2G30050 transducin family protein / WD... Lus10011429 8.7 0.9467
AT5G06660 Protein of unknown function DU... Lus10029308 9.2 0.9407
AT4G26000 PEP PEPPER, RNA-binding KH domain-... Lus10026963 9.2 0.9059
AT1G76810 eukaryotic translation initiat... Lus10030500 9.5 0.9442
AT2G16250 Leucine-rich repeat protein ki... Lus10023570 9.5 0.9267

Lus10008820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.