Lus10008822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54000 132 / 1e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G49390 129 / 1e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20400 120 / 3e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20550 119 / 6e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 71 / 1e-14 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT2G38240 67 / 1e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G11180 67 / 2e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25300 67 / 3e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G17010 66 / 8e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 65 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039975 180 / 3e-56 AT1G49390 309 / 5e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008826 159 / 4e-48 AT1G49390 298 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008824 113 / 2e-30 AT1G49390 410 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016145 77 / 3e-17 AT5G20550 225 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006518 73 / 2e-15 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10004808 71 / 9e-15 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011981 70 / 2e-14 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Lus10014134 69 / 5e-14 AT4G22880 559 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2)
Lus10011985 69 / 7e-14 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G121700 120 / 5e-33 AT5G20400 426 / 8e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G121800 118 / 3e-32 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G062500 115 / 2e-31 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030451 100 / 2e-25 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030500 100 / 2e-25 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030400 99 / 4e-25 AT1G49390 320 / 2e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G023600 71 / 1e-14 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 68 / 7e-14 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G381700 67 / 1e-13 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.010G023550 65 / 2e-13 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10008822 pacid=23151897 polypeptide=Lus10008822 locus=Lus10008822.g ID=Lus10008822.BGIv1.0 annot-version=v1.0
ATGTACCCCAACAGCATAAACGAAGGCCAATCCCCTTTTCTTCTTCCAGAGATAGACCTTCCAATCATTGATGCCAGCCACTTCATAACTACTTCTTCAG
ACACACAGCAGAATTATCCAACCAAACAACTTGGAAACCTCCGTGCAGCTCTCAGCTCACTCGGCTGCATAATGATAAAGAACCATGGAGTGGAGACTTG
TCTTCTGGACAAAGTGCTGCTGATGTTCAAGCAATTCGCTGCGCTTCCAACGCAAGAGAAGGCGAAATACGAGAGGGAAATCGAGGGTTTTGAAGGATTT
GGAAGTGACCGTTTAGTTACACAAGTAGTGGTGCATGACTGGTGTGCTAGATTCCGGCTCACACTACTGCCTCAAGAGAAGAGACAGTTAAAGTATTGGC
CCAAACATCCACTCGATTTCTGTACAGTTATGGATGAGTACAGCAGGAAGCTGCAAGTGCTCCACGATTCGATCCTGAAGGCCATGGAGAGGTTGGAAGT
GGCGGCTGTCCGCCACACTTAA
AA sequence
>Lus10008822 pacid=23151897 polypeptide=Lus10008822 locus=Lus10008822.g ID=Lus10008822.BGIv1.0 annot-version=v1.0
MYPNSINEGQSPFLLPEIDLPIIDASHFITTSSDTQQNYPTKQLGNLRAALSSLGCIMIKNHGVETCLLDKVLLMFKQFAALPTQEKAKYEREIEGFEGF
GSDRLVTQVVVHDWCARFRLTLLPQEKRQLKYWPKHPLDFCTVMDEYSRKLQVLHDSILKAMERLEVAAVRHT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G54000 2-oxoglutarate (2OG) and Fe(II... Lus10008822 0 1
AT2G42760 unknown protein Lus10019924 2.0 0.9042
AT1G01390 UDP-Glycosyltransferase superf... Lus10037115 3.2 0.8523
AT5G59530 2-oxoglutarate (2OG) and Fe(II... Lus10022196 4.7 0.8712
Lus10018648 4.9 0.8603
AT2G44800 2-oxoglutarate (2OG) and Fe(II... Lus10011002 5.3 0.7670
AT5G09520 PELPK2 Pro-Glu-Leu|Ile|Val-Pro-Lys 2,... Lus10018647 5.7 0.8539
AT1G79720 Eukaryotic aspartyl protease f... Lus10041621 9.5 0.8013
Lus10017791 20.2 0.7931
AT3G45780 RPT1, NPH1, JK2... ROOT PHOTOTROPISM 1, NONPHOTOT... Lus10018122 22.9 0.8080
AT1G05870 Protein of unknown function (D... Lus10025562 25.7 0.7772

Lus10008822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.