Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19720 90 / 6e-22 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G03540 84 / 1e-19 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G37170 82 / 4e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G13770 81 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53360 79 / 5e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G16480 79 / 6e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G13270 78 / 8e-18 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G13600 78 / 8e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G52850 77 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G52630 77 / 3e-17 MEF1 mitochondrial RNAediting factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022368 [exp] 233 / 2e-72 AT2G13600 414 / 2e-129 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012206 [exp] 83 / 1e-19 AT5G52630 786 / 0.0 mitochondrial RNAediting factor 1 (.1) Lus10011323 [exp] 82 / 3e-19 AT5G52630 790 / 0.0 mitochondrial RNAediting factor 1 (.1) Lus10033713 [exp] 82 / 3e-19 AT1G03540 726 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10033946 [exp] 79 / 4e-18 AT4G18750 410 / 1e-132 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004081 [exp] 79 / 6e-18 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040504 [exp] 78 / 1e-17 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004751 [exp] 77 / 2e-17 AT5G55740 577 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022125 [exp] 77 / 4e-17 AT5G11490 1337 / 0.0 adaptin family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G018800 [exp] 120 / 1e-32 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G066100 [exp] 100 / 9e-26 AT5G13270 977 / 0.0 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G047600 [exp] 81 / 6e-19 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 81 / 1e-18 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G095100 [exp] 80 / 2e-18 AT5G50390 865 / 0.0 EMBRYO DEFECTIVE 3141, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.016G051300 [exp] 80 / 2e-18 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G053500 [exp] 80 / 2e-18 AT5G52630 785 / 0.0 mitochondrial RNAediting factor 1 (.1) Potri.014G087100 [exp] 78 / 9e-18 AT2G46050 516 / 8e-178 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.005G215500 [exp] 77 / 2e-17 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G145000 [exp] 76 / 4e-17 AT1G03540 721 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10008829 pacid=23169169 polypeptide=Lus10008829 locus=Lus10008829.g ID=Lus10008829.BGIv1.0 annot-version=v1.0 ATGGTTCACGCTCACGCAATAATAATCGGCTTCGGAGGCCGTGAGTCCGTCAACATCAAGTTGCTCCAAATGTACAGGAAGTGCGGTTGTTTGCAGGATG CACAACATCTGTTCGACAAAATGTCGCAAAGAAACTTGTTCGCTTGGACGGCTATCATCGGCGTCTATCTGGACCACGGACGGCTTGAGGAAGCTATTTC ATACTTTGGAGAATTGATGCTTCAAGATGATGTTGCTCTGGATTCTTACGTGTTCTCGACGATTTTCAAGGTTTGTGGCGGCCTTGACATGGTGGAACTC GGGTGGCAGCTACATGGAATAGTGATCAAATTTGGATTTTATCTTGATGTGAAATGCTTTGATAGATACTTATGGTAA
AA sequence Show only first row Show all	>Lus10008829 pacid=23169169 polypeptide=Lus10008829 locus=Lus10008829.g ID=Lus10008829.BGIv1.0 annot-version=v1.0 MVHAHAIIIGFGGRESVNIKLLQMYRKCGCLQDAQHLFDKMSQRNLFAWTAIIGVYLDHGRLEEAISYFGELMLQDDVALDSYVFSTIFKVCGGLDMVEL GWQLHGIVIKFGFYLDVKCFDRYLW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16480			Tetratricopeptide repeat (TPR)...		Lus10008829 [exp]	0	1
AT3G20440		EMB2729, BE1	EMBRYO DEFECTIVE 2729, BRANCHI...		Lus10003675 [exp]	1.0	0.9374
AT2G02750			Pentatricopeptide repeat (PPR)...		Lus10030787 [exp]	2.0	0.9366
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10039149 [exp]	4.7	0.9056
AT3G03710		PDE326, PNP, RI...	resistant to inhibition with F...		Lus10001331 [exp]	4.9	0.9356
AT4G31210			DNA topoisomerase, type IA, co...		Lus10026991 [exp]	6.3	0.9320
AT3G22690			unknown protein		Lus10039355 [exp]	8.4	0.9059
AT3G11460			Pentatricopeptide repeat (PPR)...		Lus10022703 [exp]	9.5	0.9117
					Lus10036489 [exp]	10.1	0.9156
AT2G17140			Pentatricopeptide repeat (PPR)...		Lus10026545 [exp]	13.6	0.9203
AT1G06950		ATTIC110, TIC11...	ARABIDOPSIS THALIANA TRANSLOCO...		Lus10026424 [exp]	13.9	0.9126

Compare expression of checked genes

Lus10008829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.