Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008841 pacid=23169158 polypeptide=Lus10008841 locus=Lus10008841.g ID=Lus10008841.BGIv1.0 annot-version=v1.0 ATGTATTCAAGGAGCATAGCAGCTACCAATCTTTTGTTTAATTGGTTTGATGAACCGATTATGTTGATGGATTCTGCACTCATGTTCCCCCCAACTCTCA AGCCCCATCCCCCACCTACCAACCCTCAAGCCTTACCTCAGGTACCCGGTGTTAATGATCTGCAGCAGCAAGTAGTGATTATTGGGAGTGATGCACCACC AGTCAATGGCAATGTTGTTGCTGGTGTTCTTAGATAG
AA sequence Show only first row Show all	>Lus10008841 pacid=23169158 polypeptide=Lus10008841 locus=Lus10008841.g ID=Lus10008841.BGIv1.0 annot-version=v1.0 MYSRSIAATNLLFNWFDEPIMLMDSALMFPPTLKPHPPPTNPQALPQVPGVNDLQQQVVIIGSDAPPVNGNVVAGVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008841 [exp]	0	1
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10039945 [exp]	1.4	0.8756
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10013130 [exp]	6.2	0.8225
AT4G25590		ADF7	actin depolymerizing factor 7 ...		Lus10014977 [exp]	7.2	0.7877
					Lus10017698 [exp]	9.2	0.7723
AT4G35160			O-methyltransferase family pro...		Lus10018629 [exp]	12.0	0.7910
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Lus10007404 [exp]	14.7	0.7599
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10006669 [exp]	15.2	0.7800
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10013916 [exp]	15.7	0.7598
					Lus10021979 [exp]	19.7	0.6699
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10007013 [exp]	20.5	0.7264

Compare expression of checked genes

Lus10008841 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.