Lus10008847 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00850 66 / 4e-15 GIF3 GRF1-interacting factor 3 (.1)
AT1G01160 65 / 8e-15 GIF2 GRF1-interacting factor 2 (.1.2)
AT5G28640 51 / 1e-09 ATGIF1, GIF1, AN3 ARABIDOPSIS GRF1-INTERACTING FACTOR 1, ANGUSTIFOLIA 3, SSXT family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027132 62 / 3e-14 AT4G00850 148 / 7e-46 GRF1-interacting factor 3 (.1)
Lus10032892 62 / 1e-13 AT4G00850 185 / 3e-59 GRF1-interacting factor 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G103900 65 / 9e-15 AT4G00850 132 / 3e-38 GRF1-interacting factor 3 (.1)
Potri.002G177600 60 / 7e-13 AT4G00850 152 / 4e-46 GRF1-interacting factor 3 (.1)
Potri.012G023100 54 / 8e-11 AT4G00850 90 / 6e-23 GRF1-interacting factor 3 (.1)
Potri.013G043700 54 / 1e-10 AT5G28640 134 / 4e-39 ARABIDOPSIS GRF1-INTERACTING FACTOR 1, ANGUSTIFOLIA 3, SSXT family protein (.1)
Potri.019G013100 52 / 4e-10 AT5G28640 135 / 1e-39 ARABIDOPSIS GRF1-INTERACTING FACTOR 1, ANGUSTIFOLIA 3, SSXT family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05030 SSXT SSXT protein (N-terminal region)
Representative CDS sequence
>Lus10008847 pacid=23169164 polypeptide=Lus10008847 locus=Lus10008847.g ID=Lus10008847.BGIv1.0 annot-version=v1.0
ATGCAGCAGACGCCGCCACAGCCACAGCAAGGGACGATGATGAACGCTACGTCTCCGGCCAACGTCACCACCGAGCAGATTCAGAAGTACTTGGATGAGA
ACAAGAAGCTAATTATGGCTATCCTGGAGCATCAAAGTGTTGGCAAGGCCGCTGAATGTTCCCAGTGA
AA sequence
>Lus10008847 pacid=23169164 polypeptide=Lus10008847 locus=Lus10008847.g ID=Lus10008847.BGIv1.0 annot-version=v1.0
MQQTPPQPQQGTMMNATSPANVTTEQIQKYLDENKKLIMAILEHQSVGKAAECSQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01160 GIF2 GRF1-interacting factor 2 (.1.... Lus10008847 0 1
AT2G42800 AtRLP29 receptor like protein 29 (.1) Lus10031383 8.1 0.9356
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10037371 8.8 0.9468
AT3G06720 IMPA1, IMPA-1, ... importin alpha isoform 1 (.1.2... Lus10001534 11.0 0.9345
AT2G20515 unknown protein Lus10024890 12.8 0.9219
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10040522 17.1 0.9439
AT5G60370 unknown protein Lus10023342 17.3 0.9163
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10021157 20.5 0.9287
AT1G09200 Histone superfamily protein (.... Lus10005270 23.7 0.9294
AT5G14920 Gibberellin-regulated family p... Lus10039443 26.3 0.9332
AT5G65005 Polynucleotidyl transferase, r... Lus10041342 29.8 0.9281

Lus10008847 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.