Lus10008848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53650 83 / 5e-23 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032946 116 / 4e-36 AT5G53650 110 / 6e-34 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G022900 83 / 6e-23 AT5G53650 82 / 2e-22 unknown protein
Potri.015G006500 82 / 2e-22 AT5G53650 78 / 7e-21 unknown protein
PFAM info
Representative CDS sequence
>Lus10008848 pacid=23169157 polypeptide=Lus10008848 locus=Lus10008848.g ID=Lus10008848.BGIv1.0 annot-version=v1.0
ATGGGTTATGTGTTGAGGGTGAGATTGGCGTCGTTCTTCGCCGGAGCGGCAACGGCTTCTTTCGTCGGACTGTACAGCCTGTACAAGGATTACAAAGTTG
CTCATGAATCCATCTCTCAACAGGTGAAGGGACTTTACGAGACACTCGATGCCCGGATTTCTGCTCTGGAGAATTTGAAACAAACTGAAGTTTCTCAAGC
GGCAGATGCGACAGAGTAG
AA sequence
>Lus10008848 pacid=23169157 polypeptide=Lus10008848 locus=Lus10008848.g ID=Lus10008848.BGIv1.0 annot-version=v1.0
MGYVLRVRLASFFAGAATASFVGLYSLYKDYKVAHESISQQVKGLYETLDARISALENLKQTEVSQAADATE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53650 unknown protein Lus10008848 0 1
AT1G05205 unknown protein Lus10039669 1.4 0.9250
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10011491 2.4 0.8915
AT4G20150 unknown protein Lus10036250 2.4 0.9069
AT3G22110 PAC1 20S proteasome alpha subunit C... Lus10004236 5.9 0.8897
AT5G18800 Cox19-like CHCH family protein... Lus10033991 6.0 0.9066
AT3G07910 unknown protein Lus10039527 6.0 0.8768
AT1G58100 TCP TCP8 TCP domain protein 8, TCP fami... Lus10015479 6.2 0.8532
AT3G05070 unknown protein Lus10026367 6.9 0.8882
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10041194 8.4 0.8940
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10015000 9.2 0.8981

Lus10008848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.