Lus10008858 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58360 63 / 6e-13 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
AT1G10010 61 / 5e-12 AAP8, ATAAP8 amino acid permease 8 (.1)
AT5G23810 56 / 2e-10 AAP7 amino acid permease 7 (.1.2)
AT1G44100 55 / 4e-10 AAP5 amino acid permease 5 (.1)
AT5G49630 54 / 9e-10 AAP6 amino acid permease 6 (.1)
AT1G77380 52 / 3e-09 AAP3, ATAAP3 amino acid permease 3 (.1)
AT5G09220 50 / 2e-08 AAP2 amino acid permease 2 (.1)
AT5G63850 49 / 7e-08 AAP4 amino acid permease 4 (.1)
AT1G25530 38 / 0.0005 Transmembrane amino acid transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007235 74 / 2e-16 AT5G49630 720 / 0.0 amino acid permease 6 (.1)
Lus10028236 72 / 5e-16 AT5G49630 687 / 0.0 amino acid permease 6 (.1)
Lus10042740 60 / 1e-11 AT1G77380 698 / 0.0 amino acid permease 3 (.1)
Lus10036777 60 / 1e-11 AT1G77380 684 / 0.0 amino acid permease 3 (.1)
Lus10037150 60 / 1e-11 AT1G77380 680 / 0.0 amino acid permease 3 (.1)
Lus10029702 58 / 4e-11 AT1G77380 706 / 0.0 amino acid permease 3 (.1)
Lus10018852 57 / 2e-10 AT1G77380 702 / 0.0 amino acid permease 3 (.1)
Lus10028546 56 / 2e-10 AT1G77380 552 / 0.0 amino acid permease 3 (.1)
Lus10029707 56 / 4e-10 AT1G77380 759 / 0.0 amino acid permease 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G112100 70 / 2e-15 AT5G49630 691 / 0.0 amino acid permease 6 (.1)
Potri.001G470200 59 / 2e-11 AT5G09220 543 / 0.0 amino acid permease 2 (.1)
Potri.001G470000 58 / 3e-11 AT5G23810 570 / 0.0 amino acid permease 7 (.1.2)
Potri.011G167000 58 / 5e-11 AT5G23810 573 / 0.0 amino acid permease 7 (.1.2)
Potri.006G236000 57 / 6e-11 AT1G10010 580 / 0.0 amino acid permease 8 (.1)
Potri.009G085000 56 / 3e-10 AT1G58360 546 / 0.0 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
Potri.011G167200 55 / 5e-10 AT5G23810 518 / 0.0 amino acid permease 7 (.1.2)
Potri.005G068900 55 / 6e-10 AT5G09220 799 / 0.0 amino acid permease 2 (.1)
Potri.011G167532 54 / 7e-10 AT5G23810 396 / 1e-132 amino acid permease 7 (.1.2)
Potri.007G100100 54 / 7e-10 AT5G09220 768 / 0.0 amino acid permease 2 (.1)
PFAM info
Representative CDS sequence
>Lus10008858 pacid=23144216 polypeptide=Lus10008858 locus=Lus10008858.g ID=Lus10008858.BGIv1.0 annot-version=v1.0
ATGGTGATATACGGGTGCATCCAGCTGATATTGAGCCAGATCCCCGAGTTTCACAAATTTTCATGGCTATCAGTTATGGCTTCAATCATATCTTTTGGCT
ATTCGAGCATCGGCCTTGGACTCTCCATTGCCATATTCGGGACTGTTCTGAGCTGTTTCCTTCTAGCTACTGACGGTGTATTTCCCTGTGGAGAAGCACA
TTGCCCGGACACAGACTCTCAGATCCTCCGTCAAGTGGATTTTGCTGAAGATGCTGACGTGGGCATGCTTGGTGTCTCCCTTCTTGCCGGCATCGGATAT
CTCTAA
AA sequence
>Lus10008858 pacid=23144216 polypeptide=Lus10008858 locus=Lus10008858.g ID=Lus10008858.BGIv1.0 annot-version=v1.0
MVIYGCIQLILSQIPEFHKFSWLSVMASIISFGYSSIGLGLSIAIFGTVLSCFLLATDGVFPCGEAHCPDTDSQILRQVDFAEDADVGMLGVSLLAGIGY
L

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Lus10008858 0 1
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10043380 10.2 0.7583
AT5G20240 MADS PI, PISTILLATA PISTILLATA, K-box region and M... Lus10029719 10.3 0.8015
AT1G69120 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-bo... Lus10026679 15.1 0.7930
AT4G31880 unknown protein Lus10026078 16.5 0.7918
AT2G02340 ATPP2-B8 phloem protein 2-B8 (.1) Lus10025662 21.5 0.7912
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10004067 24.1 0.7912
AT1G17930 Aminotransferase-like, plant m... Lus10005482 26.4 0.7912
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10022473 28.5 0.7912
AT4G10950 SGNH hydrolase-type esterase s... Lus10023070 30.5 0.7912
AT1G34575 FAD-binding Berberine family p... Lus10023373 32.3 0.7912

Lus10008858 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.