Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14010 58 / 8e-12 RALFL32 ralf-like 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023223 [exp] 135 / 3e-42 AT4G14010 83 / 2e-21 ralf-like 32 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G321300 [exp] 75 / 2e-18 AT4G14010 60 / 1e-12 ralf-like 32 (.1) Potri.017G059800 [exp] 72 / 3e-17 AT4G14010 70 / 1e-16 ralf-like 32 (.1) Potri.001G321500 [exp] 58 / 7e-12 AT4G14010 54 / 3e-10 ralf-like 32 (.1) Potri.017G059900 [exp] 56 / 4e-11 AT4G14010 45 / 4e-07 ralf-like 32 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10008885 pacid=23144257 polypeptide=Lus10008885 locus=Lus10008885.g ID=Lus10008885.BGIv1.0 annot-version=v1.0 ATGGAGAAACCCTCTTTCCTCCTATTCATCTTCTTCCTCCATGTACTAGTTTCAGCTGCAGCAAGTACTTGTTCATCTCCAACATTAGCCACACCGTCAA TCTGTACTAGTACAGCTGGTAACAGTACTACTACTACCATGCTAATGATGTCAGCCGAAAACGAAGTCATTAGGGGGAAGAGGAGATATGTACAGGAGGC CAGAGCTGCGTCGACGAACAAGTACATAACTCCGGGAGCTTTGAAGAAAGATCAACCGGTGTGTAATGGCGGAAGCAGTGGACAGTCTTACAGTAGCAGC TGCTTGCCCCCTCCTTCAAATCCTCATACTCGTGGCTGTTCCAGATACTATCGCTGTCGTTCTGATTCTTGA
AA sequence Show only first row Show all	>Lus10008885 pacid=23144257 polypeptide=Lus10008885 locus=Lus10008885.g ID=Lus10008885.BGIv1.0 annot-version=v1.0 MEKPSFLLFIFFLHVLVSAAASTCSSPTLATPSICTSTAGNSTTTTMLMMSAENEVIRGKRRYVQEARAASTNKYITPGALKKDQPVCNGGSSGQSYSSS CLPPPSNPHTRGCSRYYRCRSDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14010		RALFL32	ralf-like 32 (.1)		Lus10008885 [exp]	0	1
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Lus10022725 [exp]	4.9	0.7641
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10042140 [exp]	6.3	0.7113
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10004230 [exp]	14.4	0.6987
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10005343 [exp]	17.4	0.7147
AT1G10750			Protein of Unknown Function (D...		Lus10013046 [exp]	20.0	0.7056
AT1G20823			RING/U-box superfamily protein...		Lus10015837 [exp]	43.2	0.6251
AT5G02440			unknown protein		Lus10016560 [exp]	58.0	0.6092
AT3G22060			Receptor-like protein kinase-r...		Lus10039698 [exp]	67.7	0.6728
AT3G22060			Receptor-like protein kinase-r...		Lus10039699 [exp]	70.4	0.6654
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Lus10014188 [exp]	71.1	0.6710

Compare expression of checked genes

Lus10008885 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.