Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23730 109 / 3e-30 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 99 / 2e-26 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G25810 98 / 6e-26 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 91 / 2e-23 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 91 / 2e-23 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30270 90 / 4e-23 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT4G25820 90 / 8e-23 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1) AT5G57530 89 / 2e-22 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT2G18800 89 / 2e-22 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT5G48070 85 / 4e-21 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023221 [exp] 173 / 6e-55 AT3G23730 376 / 4e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10004723 [exp] 102 / 9e-28 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10000678 [exp] 102 / 1e-27 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 102 / 2e-27 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10028947 [exp] 100 / 9e-27 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10021638 [exp] 99 / 2e-26 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 97 / 2e-25 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10011984 [exp] 89 / 8e-24 AT4G25810 202 / 4e-66 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Lus10003048 [exp] 92 / 1e-23 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G077320 [exp] 106 / 3e-29 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.005G201250 [exp] 103 / 4e-28 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.014G146100 [exp] 102 / 1e-27 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.005G201200 [exp] 102 / 2e-27 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060500 [exp] 101 / 2e-27 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 101 / 3e-27 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G236200 [exp] 100 / 1e-26 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 96 / 7e-25 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.011G077380 [exp] 94 / 2e-24 AT4G14130 345 / 2e-119 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.006G071200 [exp] 94 / 3e-24 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00722 [flax] [poplar] Glyco_hydro_16 Glycosyl hydrolases family 16
Representative CDS sequence Show only first row Show all	>Lus10008887 pacid=23144252 polypeptide=Lus10008887 locus=Lus10008887.g ID=Lus10008887.BGIv1.0 annot-version=v1.0 ATGGGTTACCGGTTTTATAACTGGTTGTTGTCACCCAATAACAAAAACCAGCTGCTAATTCGGGCATTAGTAATGGTGACGATGCTGATGTCGATGCAGC AAACGGCGGAAGGAGGGAATTTCAACGAGGACGTTGACCTGACGTGGGGTGGCGAGCGGGCACAAATCAAGGACGGCGGGAACCTGATCTCGCTGTCCCT CGATCGGGACTCTGGATCGGGTTTCCAGTCCAAATCTGATTACATGTTCGCCAGGATTGATTTGCAGCTTAAACTCGTCCCACGCGACGCTGCTGGTACC GTCACTGCCTATTACGTGAGTTTCCCAAGCTAA
AA sequence Show only first row Show all	>Lus10008887 pacid=23144252 polypeptide=Lus10008887 locus=Lus10008887.g ID=Lus10008887.BGIv1.0 annot-version=v1.0 MGYRFYNWLLSPNNKNQLLIRALVMVTMLMSMQQTAEGGNFNEDVDLTWGGERAQIKDGGNLISLSLDRDSGSGFQSKSDYMFARIDLQLKLVPRDAAGT VTAYYVSFPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10008887 [exp]	0	1

Compare expression of checked genes

Lus10008887 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.