Lus10008888 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 283 / 9e-97 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 278 / 7e-95 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G57560 239 / 2e-79 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57550 236 / 2e-78 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 231 / 1e-76 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT4G25810 231 / 1e-76 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G48070 225 / 3e-74 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G30290 223 / 2e-73 XTH19, ATXTH19 xyloglucan endotransglucosylase/hydrolase 19 (.1)
AT5G57530 223 / 4e-73 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT1G65310 222 / 6e-73 XTH17, XTR1, ATXTH17 xyloglucan endotransglucosylase/hydrolase 17 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023221 407 / 8e-146 AT3G23730 376 / 4e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 288 / 3e-99 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10008522 269 / 3e-91 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10004723 265 / 9e-90 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 258 / 5e-87 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 256 / 4e-86 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 250 / 6e-84 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 249 / 1e-83 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 247 / 7e-83 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 282 / 1e-96 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 275 / 1e-93 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 266 / 2e-90 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 266 / 3e-90 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 260 / 7e-88 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 252 / 9e-85 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.011G077320 252 / 1e-84 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095200 248 / 3e-83 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 248 / 4e-83 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077380 248 / 5e-83 AT4G14130 345 / 2e-119 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10008888 pacid=23144246 polypeptide=Lus10008888 locus=Lus10008888.g ID=Lus10008888.BGIv1.0 annot-version=v1.0
ATGTACATCTACGACGATCAAAAGTTGTCATCACAAGGGCCAATCCACGACGAAATCGACTTCGAGTTCCTCGGAAACGTCAGCGGGCAGCCTTACACGC
TACACACCAACGTGTACACGCACGGACACGGCAACCGAGAGCAACAGTTCTTCCTCTGGTTCGATCCCACTAGAAACTTCCACACTTACTCCATCATCTG
GAAGCCCCAACACATCATATTCTTGGTGGACCACATCCCGATAAGGGTGTTCAAGAATCTGAGGAAGTACGGGGTGCCGTTCCCGAGGAAGCAGCCGATG
AAGCTCTACTGCAGCCTTTGGGACGCCGACGACTGGGCGACACGTGGCGGGTTGGTCAAGACCGACTGGTCAATGGCGCCTTTCACTTCCTACTTCCGTA
ACTTCCAAGCAACTCCGTACACCAACTTCGCCCACAACGGCCGGGGCAAGTTCAGGGAAGCCGGGGACCCGGATCTCGACGCGTACGCGAGGAGACGGCT
CCGGTGGGTCGAGAAGTACTTCATGATCTATAACTACTGCACAGATGTCAACCGGTTCCAGGGCCGTCTCCCCCCTGAATGCAAACACTCTAGGGCACTA
TGA
AA sequence
>Lus10008888 pacid=23144246 polypeptide=Lus10008888 locus=Lus10008888.g ID=Lus10008888.BGIv1.0 annot-version=v1.0
MYIYDDQKLSSQGPIHDEIDFEFLGNVSGQPYTLHTNVYTHGHGNREQQFFLWFDPTRNFHTYSIIWKPQHIIFLVDHIPIRVFKNLRKYGVPFPRKQPM
KLYCSLWDADDWATRGGLVKTDWSMAPFTSYFRNFQATPYTNFAHNGRGKFREAGDPDLDAYARRRLRWVEKYFMIYNYCTDVNRFQGRLPPECKHSRAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10008888 0 1
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Lus10000008 1.7 1.0000
Lus10001123 3.5 1.0000
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10011252 3.5 1.0000
AT1G47550 SEC3A exocyst complex component sec3... Lus10001022 4.2 1.0000
Lus10023352 4.5 1.0000
Lus10026785 4.6 1.0000
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029384 5.2 1.0000
AT3G14040 Pectin lyase-like superfamily ... Lus10039150 6.0 1.0000
Lus10024677 6.2 0.9907
Lus10028048 6.3 1.0000

Lus10008888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.