Lus10008892 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 48 / 7e-07 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023215 276 / 6e-96 AT1G47960 48 / 6e-07 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 54 / 4e-09 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 51 / 5e-08 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 43 / 4e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017346 43 / 4e-05 AT3G17220 79 / 8e-19 pectin methylesterase inhibitor 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G083500 52 / 2e-08 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 52 / 2e-08 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.006G134900 46 / 3e-06 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.013G012800 45 / 5e-06 ND /
Potri.013G012766 45 / 7e-06 ND /
Potri.010G209800 43 / 2e-05 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G127500 40 / 0.0002 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10008892 pacid=23144218 polypeptide=Lus10008892 locus=Lus10008892.g ID=Lus10008892.BGIv1.0 annot-version=v1.0
ATGGCTAACTCTTTGTCAATCACTACTCTTATACTATGCCTAGCTATGATCAATCCTTCTTCAGGGTTGCGCCACGTGCCCCAAGACGGAACACTCCTAG
ACAAAATATGTCGAGATGGCAAGATCCAACCGTTCTACGACTCATGTGTACAACTATTCACTTCAGACCCTAGAAGTGTGACGGCTGACCTCAAGGGTCT
GGTCAGGATCGCGTTGGAGAAGTCGGCACTGACAGTAGCTCGCTCACTGGTGTCCATGGACACCGCGGCCAGGTTAGGGGTGGGGAAAACAAACGACACC
GTTCGTGTCAAACTCATGCAGTGCTCCGACCGGTATAGCCAGATCATCTATGACGTCTCCGAAGGGTTTAAGTCGGGGAAAATTGGGGATTTCAATGCCG
TGGGGAACAGTGCTCTGGCTATAATCGGACAGACCAACGAATGTCTAGATGGGTTCGTTGGGCCGACAGAGGTTTCGAATGCGACTACTCGGGTGCATAA
CCTGGCCGTCATTGTAGCGGTCATTGCTACTTTGTCGACTGGCAGCTCGTAG
AA sequence
>Lus10008892 pacid=23144218 polypeptide=Lus10008892 locus=Lus10008892.g ID=Lus10008892.BGIv1.0 annot-version=v1.0
MANSLSITTLILCLAMINPSSGLRHVPQDGTLLDKICRDGKIQPFYDSCVQLFTSDPRSVTADLKGLVRIALEKSALTVARSLVSMDTAARLGVGKTNDT
VRVKLMQCSDRYSQIIYDVSEGFKSGKIGDFNAVGNSALAIIGQTNECLDGFVGPTEVSNATTRVHNLAVIVAVIATLSTGSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10008892 0 1
AT1G29450 SAUR-like auxin-responsive pro... Lus10023970 2.8 0.8131
Lus10000749 7.1 0.8072
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10025619 16.1 0.7463
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10040632 16.9 0.7463
AT1G18790 AtRKD1, RKD1 RWP-RK domain containing 1, RW... Lus10019100 17.7 0.7463
AT2G32300 UCC1 uclacyanin 1 (.1) Lus10007025 23.5 0.7367
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10005010 23.9 0.7263
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10019029 31.4 0.7734
AT4G21330 bHLH bHLH022, DYT1 DYSFUNCTIONAL TAPETUM 1, basic... Lus10007618 33.2 0.7174
AT1G09790 COBL6 COBRA-like protein 6 precursor... Lus10016188 47.2 0.6855

Lus10008892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.