Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02450 303 / 3e-101 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT1G26870 185 / 6e-55 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 178 / 2e-54 NAC ANAC032 NAC domain containing protein 32 (.1) AT2G17040 179 / 3e-54 NAC ANAC036 NAC domain containing protein 36 (.1) AT5G39820 179 / 8e-54 NAC ANAC094 NAC domain containing protein 94 (.1) AT4G27410 176 / 4e-53 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G61110 177 / 6e-53 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G01720 176 / 6e-53 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G43000 175 / 8e-53 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT3G15500 176 / 1e-52 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023208 [exp] 378 / 2e-131 AT2G02450 321 / 3e-108 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008419 [exp] 308 / 2e-102 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003367 [exp] 309 / 8e-102 AT2G02450 333 / 3e-110 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008420 [exp] 296 / 3e-98 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003269 [exp] 186 / 8e-56 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10030478 [exp] 185 / 5e-55 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10015367 [exp] 182 / 8e-55 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10006547 [exp] 183 / 1e-54 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10037178 [exp] 184 / 3e-54 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G046700 [exp] 305 / 9e-102 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.004G230800 [exp] 295 / 4e-98 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.019G031400 [exp] 183 / 8e-55 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.001G404100 [exp] 179 / 1e-53 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G123300 [exp] 179 / 2e-53 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.009G141600 [exp] 176 / 3e-53 AT2G17040 314 / 6e-108 NAC domain containing protein 36 (.1) Potri.007G066300 [exp] 176 / 5e-53 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.013G054000 [exp] 178 / 6e-53 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2) Potri.005G180200 [exp] 176 / 6e-53 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G069500 [exp] 176 / 8e-53 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10008897 pacid=23144222 polypeptide=Lus10008897 locus=Lus10008897.g ID=Lus10008897.BGIv1.0 annot-version=v1.0 ATGAAGGAAAACAATGGCGATCACGAAGTGGTCGAAGAAGAAGAAGATGAGCATGATCATGACATGGTGATGCCAGGGTTCAGGTTCCATCCCACAGAGG AAGAGCTTATCCAGTTCTACCTTCGCCGTAAGGTTGAGGGCAAACCCTTCAACGTCGAGCTCATCACTTTCCTCGACCTTTATCGCTATGATCCCTGGCA CCTCCCTGCTATGGCGGCGATCGGGGAGAAGGAATGGTTCTTCTATGTGCCTAGGGACAGGAAGTACAGGAACGGTGATAGGCCGAACCGGGTGACCACT TCTGGTTACTGGAAGGCTACTGGGGCAGACCGGATGATTCGAGGTGAGAACTCAAGTTCGATCGGGCTGAAGAAAACCCTAGTGTTTTACTCCGGGAAGG CTCCCAAGGGGATTCGGTCTAGTTGGATTATGAATGAGTATCGTCTTCCTCACCATGACACCCAACGATACCAAAAGACGGAGATATCACTGTGTCGAGT ATACAAGAGACCAGGAGTCGAAGATCATCGCGGTGTACCATCGACATCGTCTCTTCCACGCTCTCTTCCTTCGACATTTAGGCAGGGTCGTCCAATGAAT TCCGGTGCATCCACAGCTTCTTCTGTGGGACTAATCTCCAACCAACTCCCGACACTGACTCATCACCCACTGCAACTTCCTCCTCCTCCACAACAACAAC AACAACAAGTACTAGATCATGCTCAAGAAGAAGAAGATCAGCTCATGCTCCTAAACGGTACTAACAACAATAATAATTTGGATGATTTGCATCGGCTAGT CAACTACCAACAGAATCATGATCACCCTAGTTACTTGCATCCACATCATCAGCTGCATATGTGGGAGTGGGACCCACTCCCGCCTCCGCGGGCACCTCAC CATGATCGTCAGAATCAACTTCAAGGTGGCCATAGATCGGCGGGTGATGAACATCATCATCGCCACGAGACGAACAACCACACTAATCTTTTCAAGTAG
AA sequence Show only first row Show all	>Lus10008897 pacid=23144222 polypeptide=Lus10008897 locus=Lus10008897.g ID=Lus10008897.BGIv1.0 annot-version=v1.0 MKENNGDHEVVEEEEDEHDHDMVMPGFRFHPTEEELIQFYLRRKVEGKPFNVELITFLDLYRYDPWHLPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTT SGYWKATGADRMIRGENSSSIGLKKTLVFYSGKAPKGIRSSWIMNEYRLPHHDTQRYQKTEISLCRVYKRPGVEDHRGVPSTSSLPRSLPSTFRQGRPMN SGASTASSVGLISNQLPTLTHHPLQLPPPPQQQQQQVLDHAQEEEDQLMLLNGTNNNNNLDDLHRLVNYQQNHDHPSYLHPHHQLHMWEWDPLPPPRAPH HDRQNQLQGGHRSAGDEHHHRHETNNHTNLFK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	0	1
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10023208 [exp]	1.0	0.9404
					Lus10001828 [exp]	2.4	0.8838
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10016528 [exp]	2.4	0.8991
					Lus10017461 [exp]	5.7	0.8164
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10040796 [exp]	6.6	0.8821
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	7.7	0.8340
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025911 [exp]	7.7	0.8423
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10000338 [exp]	8.4	0.8126
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025910 [exp]	9.8	0.8092
					Lus10025831 [exp]	15.6	0.8120

Compare expression of checked genes

Lus10008897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.