Lus10008906 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18730 65 / 4e-13 ATDGK3 diacylglycerol kinase 3 (.1)
AT4G30340 62 / 3e-12 ATDGK7 diacylglycerol kinase 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006991 162 / 1e-48 AT2G18730 677 / 0.0 diacylglycerol kinase 3 (.1)
Lus10015514 132 / 2e-37 AT4G30340 707 / 0.0 diacylglycerol kinase 7 (.1)
Lus10019987 130 / 8e-37 AT4G30340 713 / 0.0 diacylglycerol kinase 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G096700 100 / 5e-26 AT2G18730 702 / 0.0 diacylglycerol kinase 3 (.1)
Potri.006G174700 82 / 3e-19 AT4G30340 670 / 0.0 diacylglycerol kinase 7 (.1)
PFAM info
Representative CDS sequence
>Lus10008906 pacid=23144255 polypeptide=Lus10008906 locus=Lus10008906.g ID=Lus10008906.BGIv1.0 annot-version=v1.0
ATGGGTTCACCGACTACGACGTCGGCGACGGCGGAGAATTCCTCGACGACGACGACAAGGATCGTGGCGTCGAGGTCGTCGATGATTGACTCGTTAAGAG
GATGCGGCTTATCGGGCGTCCGAATCGACAAGGAAGTCCTGAGGAAGAAGCTCGTGATGCCGGAGTACCTCCGGCGAGCTATGGCCGACGCAATCAAGTC
CAAGGACGCGGCGGAGGCTTGTGATCGTCACCGCAGTAGTACCTCCGAACCCAGAGTCCCAGAGGAGGCTCCTCAGTGCGCCATGGTCGTCTTCGTCAAC
TCCAAAAGCGGCGGCCGCCAAGGCCCCGNNNNCGGAGGGCCCCGCGCGCCCCAATGGTGGTTTTCATAA
AA sequence
>Lus10008906 pacid=23144255 polypeptide=Lus10008906 locus=Lus10008906.g ID=Lus10008906.BGIv1.0 annot-version=v1.0
MGSPTTTSATAENSSTTTTRIVASRSSMIDSLRGCGLSGVRIDKEVLRKKLVMPEYLRRAMADAIKSKDAAEACDRHRSSTSEPRVPEEAPQCAMVVFVN
SKSGGRQGPXXGGPRAPQWWFS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18730 ATDGK3 diacylglycerol kinase 3 (.1) Lus10008906 0 1
AT2G18730 ATDGK3 diacylglycerol kinase 3 (.1) Lus10008907 1.4 0.8018
AT1G41830 SKS6 SKU5 SIMILAR 6, SKU5-similar 6... Lus10025107 14.5 0.7692
AT3G54030 Protein kinase protein with te... Lus10027743 28.6 0.7515
AT1G33811 GDSL-like Lipase/Acylhydrolase... Lus10000893 37.7 0.7522
AT1G69710 Regulator of chromosome conden... Lus10036737 88.2 0.7004
AT5G01990 Auxin efflux carrier family pr... Lus10003240 113.1 0.7144
AT2G01600 ENTH/ANTH/VHS superfamily prot... Lus10013469 119.6 0.6865
AT4G35160 O-methyltransferase family pro... Lus10001510 173.4 0.7335
AT4G38840 SAUR-like auxin-responsive pro... Lus10029198 219.7 0.6744
AT3G54030 Protein kinase protein with te... Lus10035550 245.0 0.6826

Lus10008906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.