Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57685 39 / 6e-05 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006987 [exp] 82 / 3e-21 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10008910 [exp] 62 / 3e-13 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10006986 [exp] 60 / 1e-12 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019985 [exp] 39 / 0.0002 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019986 [exp] 39 / 0.0002 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10015513 [exp] 39 / 0.0002 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G173901 [exp] 41 / 1e-05 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008909 pacid=23144263 polypeptide=Lus10008909 locus=Lus10008909.g ID=Lus10008909.BGIv1.0 annot-version=v1.0 ATGGAAGCCACAAGTCAACCCGTCGGCGTAAATCTTCCGGCGTCCACGTCAACAGCGGAGCCGTCGCCGTGGCATTCCCCTGTCCCGTACTTGTTCGGCG GATTAGCAGCCATGTTGGGGCTGATAGCCTTCGCCCTGCTGATCCTGGCTTGCTCCTACCGTAAGCTCTCTGGCCTCATCGAGAACGGTGAAAATGAAAG GGATCTAGAAGCAGGGGAAGGTGGAGAAATAGAGGACGAAATTGTTGTGGCGCTAGCGGAAATGTAG
AA sequence Show only first row Show all	>Lus10008909 pacid=23144263 polypeptide=Lus10008909 locus=Lus10008909.g ID=Lus10008909.BGIv1.0 annot-version=v1.0 MEATSQPVGVNLPASTSTAEPSPWHSPVPYLFGGLAAMLGLIAFALLILACSYRKLSGLIENGENERDLEAGEGGEIEDEIVVALAEM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Lus10008909 [exp]	0	1
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031236 [exp]	2.4	0.8141
AT1G04380			2-oxoglutarate (2OG) and Fe(II...		Lus10009240 [exp]	3.3	0.8635
AT4G18425			Protein of unknown function (D...		Lus10013974 [exp]	10.5	0.7411
					Lus10021851 [exp]	11.5	0.7786
AT4G12480		PEARLI 1 1, PEA...	EARLY ARABIDOPSIS ALUMINUM IND...		Lus10036494 [exp]	12.3	0.7458
					Lus10008791 [exp]	13.3	0.7786
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	14.8	0.7786
					Lus10012440 [exp]	16.2	0.7786
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10028717 [exp]	17.4	0.7687
					Lus10026713 [exp]	17.5	0.7778

Compare expression of checked genes

Lus10008909 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.