Plant FIBer expression Database

Lus10008922 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10040 215 / 5e-74 CYTC-2 cytochrome c-2 (.1)
AT1G22840 204 / 6e-70 CYTC-1, ATCYTC-A CYTOCHROME C-A, CYTOCHROME C-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028892
[exp]
233 / 2e-81 AT4G10040 214 / 7e-74 cytochrome c-2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G101601
[exp]
212 / 6e-73 AT4G10040 214 / 6e-74 cytochrome c-2 (.1)
Potri.019G076001
[exp]
210 / 3e-72 AT1G22840 211 / 2e-72 CYTOCHROME C-A, CYTOCHROME C-1 (.1.2)
Potri.019G076101
[exp]
204 / 1e-69 AT1G22840 204 / 1e-69 CYTOCHROME C-A, CYTOCHROME C-1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0318 Cytochrome-c PF00034 Cytochrom_C Cytochrome c
Representative CDS sequence
>Lus10008922 pacid=23175121 polypeptide=Lus10008922 locus=Lus10008922.g ID=Lus10008922.BGIv1.0 annot-version=v1.0
ATGGCGACCTTCAACGAAGCTCCTCCCGGTAACCCCGATGCCGGAGCAAAGATCTTCAAGACCAAGTGCGCTCAGTGCCATACCGTCGACAAAGGCGCTG
GTCACAAACAAGGTCCTAATTTGAATGGACTTTTCGGAAGGCAGTCTGGAACTACCCCAGGCTACTCATACTCTGCTGCCAACAAGAACATGGCTGTGAA
CTGGGCAGAGAACACATTGTACGACTACTTGCTTAACCCCAAGAAGTACATCCCTGGAACTAAGATGGTGTTCCCTGGACTGAAAAAGCCGCAGGAGCGT
GCTGACCTTATTGCGTATCTGAAGCAATCCACCGCCTGA
AA sequence
>Lus10008922 pacid=23175121 polypeptide=Lus10008922 locus=Lus10008922.g ID=Lus10008922.BGIv1.0 annot-version=v1.0
MATFNEAPPGNPDAGAKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWAENTLYDYLLNPKKYIPGTKMVFPGLKKPQER
ADLIAYLKQSTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10040 CYTC-2 cytochrome c-2 (.1) Lus10008922
[exp]
0 1
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10032157
[exp]
3.2 0.8904
AT1G08480 SDH6 succinate dehydrogenase 6, unk... Lus10013373
[exp]
3.2 0.8851
AT3G48610 NPC6 non-specific phospholipase C6 ... Lus10035935
[exp]
3.5 0.8765
AT5G58590 RANBP1 RAN binding protein 1 (.1) Lus10035655
[exp]
5.0 0.8790
AT2G25110 AtSDF2, ATSDL, ... ATSDF2-LIKE, Arabidopsis thali... Lus10010594
[exp]
8.7 0.8845
AT5G13450 ATP5 delta subunit of Mt ATP syntha... Lus10016414
[exp]
9.5 0.8433
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10007533
[exp]
10.4 0.8845
Lus10007581
[exp]
13.5 0.8639
AT1G48030 mtLPD1 mitochondrial lipoamide dehydr... Lus10043103
[exp]
13.5 0.8740
AT5G10730 NAD(P)-binding Rossmann-fold s... Lus10020108
[exp]
14.4 0.8612

Lus10008922 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.