Lus10008926 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008925 58 / 2e-11 AT1G09600 643 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008926 pacid=23175124 polypeptide=Lus10008926 locus=Lus10008926.g ID=Lus10008926.BGIv1.0 annot-version=v1.0
ATGAGGTGCAAGGTTTTCTTTGTGTTTGCGATTCTGTTTCTTGGTTTTGTATTCTCGACTGCGATGCCATCTGCGGACGCAGCTGGAATCGAATGTGTGA
GGTGCAACTGTAGATCATATGGGTGCCTTTGCTGCGATGCTTCTGGGACGGTACTATTGAATCAGGATGGCAAGCCAATTGCTACCTTCCTAATTCATCA
AGACGAAGCACACAAGGACGGAGGAGATTGA
AA sequence
>Lus10008926 pacid=23175124 polypeptide=Lus10008926 locus=Lus10008926.g ID=Lus10008926.BGIv1.0 annot-version=v1.0
MRCKVFFVFAILFLGFVFSTAMPSADAAGIECVRCNCRSYGCLCCDASGTVLLNQDGKPIATFLIHQDEAHKDGGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008926 0 1
Lus10018114 3.0 0.7746
Lus10035428 8.0 0.7407
AT4G37000 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOR... Lus10017952 13.3 0.7713
AT1G29430 SAUR-like auxin-responsive pro... Lus10007067 16.0 0.7089
AT3G61680 alpha/beta-Hydrolases superfam... Lus10040915 16.1 0.7402
Lus10009357 22.1 0.7177
AT4G29035 Plant self-incompatibility pro... Lus10022825 24.7 0.7513
Lus10038154 36.5 0.7358
AT2G26480 UGT76D1 UDP-glucosyl transferase 76D1 ... Lus10017203 42.1 0.6536
AT1G73110 P-loop containing nucleoside t... Lus10024092 45.1 0.7336

Lus10008926 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.