Lus10008930 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G01520 119 / 5e-35 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
AT2G01530 116 / 9e-34 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1)
AT1G70840 115 / 3e-33 MLP31 MLP-like protein 31 (.1)
AT1G14950 115 / 3e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 112 / 5e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14960 111 / 1e-31 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G14060 109 / 4e-31 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70830 110 / 5e-31 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G14940 109 / 5e-31 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028887 299 / 5e-106 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Lus10033397 231 / 1e-78 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008932 228 / 3e-76 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10042489 140 / 5e-43 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10042490 138 / 2e-42 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008931 111 / 7e-33 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10020497 79 / 3e-19 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1)
Lus10020498 78 / 2e-18 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012466 75 / 2e-17 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G131200 161 / 1e-51 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131100 161 / 2e-51 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.008G131300 133 / 1e-40 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G111000 83 / 1e-20 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051100 82 / 2e-20 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.017G051200 66 / 2e-14 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.004G032900 44 / 5e-06 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2)
Potri.004G033000 44 / 1e-05 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2)
Potri.004G020000 42 / 5e-05 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10008930 pacid=23175147 polypeptide=Lus10008930 locus=Lus10008930.g ID=Lus10008930.BGIv1.0 annot-version=v1.0
ATGGCAGCAACATCGGAGATGAGCGGGAAGCTGGAGGCGGAGGTGGAGCTGAAATCTCCGCCGGCGGAGTTCTTTAACGTGTTCAGGAAAGCAGCTCACC
ACATCCCAACGCACACTCCTTCCAATATTCAGGCTGTCAAGTGCCACCACGGCGACTGGGACAGTCACGACGGCATCAAGATCTGGAACTACACCTGTGA
GGGGAAGGCGGAGGTGTTCAAGGAGAGGGTGGAGTTCGACGAGCAGAATAAGATCGTGAAACTGAACGGCTTAGAAGGAGATGTGATGAAGATATATAAA
GTGTACAATCCGATTTTCGAGTTCGTGACGAAAAGTGGAGGGCCCGGTGGAGTGGCAAAGCTGGCCATTGAGTACGAGAAGCTGGACCCGAGTTTCCCGC
CTCCAACCAAGTACCTGGATTTCATGATCGATCTTACCAAGGAGACTGATGTTGGCCTTGTTAAAGTCGGTTGA
AA sequence
>Lus10008930 pacid=23175147 polypeptide=Lus10008930 locus=Lus10008930.g ID=Lus10008930.BGIv1.0 annot-version=v1.0
MAATSEMSGKLEAEVELKSPPAEFFNVFRKAAHHIPTHTPSNIQAVKCHHGDWDSHDGIKIWNYTCEGKAEVFKERVEFDEQNKIVKLNGLEGDVMKIYK
VYNPIFEFVTKSGGPGGVAKLAIEYEKLDPSFPPPTKYLDFMIDLTKETDVGLVKVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28010 Polyketide cyclase/dehydrase a... Lus10008930 0 1
AT4G14060 Polyketide cyclase/dehydrase a... Lus10008932 1.0 0.9632
Lus10028788 1.4 0.9586
AT4G35160 O-methyltransferase family pro... Lus10023987 3.5 0.9492
Lus10042813 3.5 0.9338
AT1G71890 SUC5, ATSUC5 SUCROSE-PROTON SYMPORTER 5, Ma... Lus10028886 3.9 0.9265
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10013130 4.9 0.9158
AT1G54730 Major facilitator superfamily ... Lus10002258 6.0 0.9256
Lus10018646 6.2 0.8662
AT4G35160 O-methyltransferase family pro... Lus10018629 6.3 0.9058
AT1G67110 CYP735A2 "cytochrome P450, family 735, ... Lus10006246 7.7 0.8947

Lus10008930 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.