Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70870 59 / 5e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70840 53 / 3e-10 MLP31 MLP-like protein 31 (.1) AT1G23120 51 / 1e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28000 50 / 4e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28010 50 / 4e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G23130 48 / 2e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14950 47 / 6e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G14060 46 / 7e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70830 45 / 2e-07 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G35260 44 / 4e-07 MLP165 MLP-like protein 165 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008930 [exp] 111 / 3e-33 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028887 [exp] 100 / 1e-28 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) Lus10008932 [exp] 96 / 6e-26 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10033397 [exp] 82 / 2e-21 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 55 / 4e-11 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042489 [exp] 52 / 7e-10 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10026175 [exp] 47 / 6e-08 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10039893 [exp] 41 / 2e-06 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002176 [exp] 39 / 7e-05 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131200 [exp] 71 / 3e-17 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131100 [exp] 62 / 4e-14 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.008G131300 [exp] 60 / 4e-13 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.017G051100 [exp] 49 / 9e-09 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 46 / 4e-08 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G111000 [exp] 43 / 2e-06 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.004G020000 [exp] 40 / 1e-05 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G020100 [exp] 39 / 6e-05 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10008931 pacid=23175120 polypeptide=Lus10008931 locus=Lus10008931.g ID=Lus10008931.BGIv1.0 annot-version=v1.0 ATGTATGCTTTAGAAGGAGATGTGATGAAGATATACAAAGTGTACACTGCGATTTTTGAGTTCGTGACGAAAAGTCGAGGGCCCAGTGGGGTGGCAAAGC TAACCATTGAGTACGAGAAGCTGGACCCGAGTTCCCCACCTCCAACCAAGTACTTGGATCTATTGATCAAGGTTACCAAGGAGATTGATGTTGCCCTTGT TAAAGTCAGTTGA
AA sequence Show only first row Show all	>Lus10008931 pacid=23175120 polypeptide=Lus10008931 locus=Lus10008931.g ID=Lus10008931.BGIv1.0 annot-version=v1.0 MYALEGDVMKIYKVYTAIFEFVTKSRGPSGVAKLTIEYEKLDPSSPPPTKYLDLLIKVTKEIDVALVKVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70870			Polyketide cyclase/dehydrase a...		Lus10008931 [exp]	0	1
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Lus10007411 [exp]	1.0	0.8126
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Lus10005917 [exp]	1.4	0.7978
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10030206 [exp]	2.2	0.7225
AT1G69930		ATGSTU11	glutathione S-transferase TAU ...		Lus10029518 [exp]	4.9	0.7812
AT1G54870			NAD(P)-binding Rossmann-fold s...		Lus10034048 [exp]	8.7	0.7564
AT5G14710			unknown protein		Lus10014543 [exp]	20.9	0.7217
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10032324 [exp]	24.7	0.7027
					Lus10033211 [exp]	35.9	0.6998
AT5G01750			Protein of unknown function (D...		Lus10020780 [exp]	36.8	0.5947
AT3G46580		MBD05, MDB5, MD...	METHYL-CPG-BINDING DOMAIN PROT...		Lus10002234 [exp]	38.8	0.6366

Compare expression of checked genes

Lus10008931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.