Lus10008932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G01520 127 / 1e-36 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
AT1G14930 126 / 2e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14960 124 / 2e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14950 123 / 5e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G26460 122 / 6e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G26450 122 / 1e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G23680 121 / 2e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G01530 121 / 3e-34 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1)
AT1G14940 119 / 2e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033397 234 / 2e-78 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008930 228 / 3e-76 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028887 227 / 1e-75 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Lus10042489 140 / 1e-41 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10042490 137 / 3e-40 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008931 96 / 3e-25 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10020498 87 / 8e-21 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10020497 84 / 4e-20 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1)
Lus10012466 81 / 9e-19 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G131100 159 / 3e-49 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.008G131200 152 / 2e-46 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131300 145 / 6e-44 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.017G051100 103 / 1e-27 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.010G111000 99 / 2e-25 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051200 87 / 2e-21 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.010G096000 65 / 5e-13 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
Potri.004G051500 64 / 1e-12 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G032900 48 / 7e-07 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2)
Potri.004G033000 47 / 2e-06 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10008932 pacid=23175167 polypeptide=Lus10008932 locus=Lus10008932.g ID=Lus10008932.BGIv1.0 annot-version=v1.0
ATGGCGGCTAAGGCGGAGGCGGAGACGACATCGGCGATAAGCGGGAAGCTGGAGGCGGAGGTGGAGCTGAAAGCACCTCCGGCGAAGTTATATAACGTAT
ACAGGAAGTCGGCACACCAAATCCCAACCCACACCCCTTCCAAAATCCAGTCCATCAAAGTCCACCAAGGCGACTGGGAGTCTCACGGCACCATCAAGAT
ATGGAACTACACTTTAGACGGGAAGGAGCAGATGTTCAAGGAAAGGGTGGAGTTCGACGACGGGAAGAAAACAGTGAAAGTGCATGGATTAGAAGGGGAC
GTGATGAAGCTGTACAAAGTTTACAATGGAATCTTCGAGTTCGTGTCTATGGGCAATGGTGATCAAGGGGTTGCCAAATTGACGATTGAATATGAGAAGC
TGGACCCAAACTTCCCACCTCCGACTAAGTTCATGGACTTCGTTGTTAGCTTTGTTAAGGACATTGATGCTGGCCTTGCCAAAGCCGAGGGGAAGGCAGA
GGTGTTGAAGGAGAGGGTGGAGTTCGACGATGAGGAAAAAACCATTAAACTGAATGGGTTAGAAGGAGATCCGATGAAGATATACAAAGTATTCAATCCC
ATGTTCAAGCTCGTGTCCGGCAAAGAAGAAGGAGGCGGCCGCGGCGGCGGAGTCGCAAAACTAAGCATCGAATATGAGAAGCTGGACTCCAGTTCCCCAC
CTCCGACCAAGTACATGGATTTCATGATCAGCCTTACCAACGAAACTGACGATGGCCTTGTTAAAGCCGTTTGA
AA sequence
>Lus10008932 pacid=23175167 polypeptide=Lus10008932 locus=Lus10008932.g ID=Lus10008932.BGIv1.0 annot-version=v1.0
MAAKAEAETTSAISGKLEAEVELKAPPAKLYNVYRKSAHQIPTHTPSKIQSIKVHQGDWESHGTIKIWNYTLDGKEQMFKERVEFDDGKKTVKVHGLEGD
VMKLYKVYNGIFEFVSMGNGDQGVAKLTIEYEKLDPNFPPPTKFMDFVVSFVKDIDAGLAKAEGKAEVLKERVEFDDEEKTIKLNGLEGDPMKIYKVFNP
MFKLVSGKEEGGGRGGGVAKLSIEYEKLDSSSPPPTKYMDFMISLTNETDDGLVKAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14060 Polyketide cyclase/dehydrase a... Lus10008932 0 1
AT5G28010 Polyketide cyclase/dehydrase a... Lus10008930 1.0 0.9632
AT1G54730 Major facilitator superfamily ... Lus10002258 1.7 0.9460
AT4G35160 O-methyltransferase family pro... Lus10023987 2.4 0.9541
AT1G71890 SUC5, ATSUC5 SUCROSE-PROTON SYMPORTER 5, Ma... Lus10028886 2.8 0.9457
AT5G37990 S-adenosyl-L-methionine-depend... Lus10028500 3.0 0.9263
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Lus10010800 5.7 0.8846
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10036942 5.9 0.9328
Lus10028788 5.9 0.9285
Lus10042813 6.0 0.9319
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10006245 6.2 0.8992

Lus10008932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.