Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01100 95 / 1e-26 60S acidic ribosomal protein family (.1.2.3.4) AT5G47700 95 / 2e-26 60S acidic ribosomal protein family (.1.2) AT5G24510 94 / 5e-26 60S acidic ribosomal protein family (.1) AT4G00810 94 / 6e-26 60S acidic ribosomal protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028876 [exp] 139 / 5e-44 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008943 [exp] 139 / 5e-44 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10002680 [exp] 118 / 1e-35 AT5G24510 122 / 2e-37 60S acidic ribosomal protein family (.1) Lus10030200 [exp] 119 / 2e-32 AT1G05600 580 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10034864 [exp] 105 / 1e-30 AT5G24510 114 / 2e-34 60S acidic ribosomal protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G004700 [exp] 94 / 2e-26 AT1G01100 96 / 4e-27 60S acidic ribosomal protein family (.1.2.3.4) Potri.012G021700 [exp] 92 / 2e-25 AT5G24510 94 / 3e-26 60S acidic ribosomal protein family (.1) Potri.014G105400 [exp] 91 / 7e-25 AT5G24510 97 / 2e-27 60S acidic ribosomal protein family (.1) Potri.002G179400 [exp] 90 / 2e-24 AT5G24510 99 / 3e-28 60S acidic ribosomal protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10008944 pacid=23175186 polypeptide=Lus10008944 locus=Lus10008944.g ID=Lus10008944.BGIv1.0 annot-version=v1.0 ATGTCGACCGGAGAGATTGCCTGCAGTTACGCCATCATGATCCTCCACGACGAGGGCATCCCTATCACAGCGGATAAGATCAGCGCATTGGTTAAGGCTG CTAATGTCAACTGTGAGTCTTACTGGGCCAGCTTGTTCGCCAAGTTGGCTGAGAAGCGTAACGTTGAGGACCTCATCTTGAACGCTGGTGCTTCCGGCGG TGGTGCTGTTGCTGCCGTCGCTGCCCCAGCTGGTGGTGCTGCTCCTGCTGCAGCTGCTGCCCCTGCTGCTGAGGAAAAGAAGGAGGAGGCCAAGGAGGAG AGCGATGATGACATGGGTTTCTCCCTGTTCGATTAG
AA sequence Show only first row Show all	>Lus10008944 pacid=23175186 polypeptide=Lus10008944 locus=Lus10008944.g ID=Lus10008944.BGIv1.0 annot-version=v1.0 MSTGEIACSYAIMILHDEGIPITADKISALVKAANVNCESYWASLFAKLAEKRNVEDLILNAGASGGGAVAAVAAPAGGAAPAAAAAPAAEEKKEEAKEE SDDDMGFSLFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24510			60S acidic ribosomal protein f...		Lus10008944 [exp]	0	1
AT1G02280		PPI1, ATTOC33, ...	PLASTID PROTEIN IMPORT 1, tran...		Lus10010292 [exp]	1.4	0.8533
AT5G52660	MYB		Homeodomain-like superfamily p...		Lus10038846 [exp]	1.7	0.8418
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	2.0	0.8650
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10011959 [exp]	3.9	0.7871
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	4.5	0.8251
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10017293 [exp]	4.5	0.8073
AT1G54380			spliceosome protein-related (....		Lus10022813 [exp]	6.6	0.8059
AT4G15770			RNA binding (.1)		Lus10000507 [exp]	8.5	0.8095
AT4G25740			RNA binding Plectin/S10 domain...		Lus10014966 [exp]	10.6	0.7388
AT5G24840			tRNA (guanine-N-7) methyltrans...		Lus10020164 [exp]	10.6	0.8138

Compare expression of checked genes

Lus10008944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.