Lus10008950 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55570 110 / 1e-31 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028870 188 / 1e-62 AT5G55570 114 / 2e-33 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G085700 55 / 9e-10 AT5G55570 68 / 2e-14 unknown protein
Potri.011G085501 0 / 1 AT5G55570 114 / 1e-31 unknown protein
PFAM info
Representative CDS sequence
>Lus10008950 pacid=23175174 polypeptide=Lus10008950 locus=Lus10008950.g ID=Lus10008950.BGIv1.0 annot-version=v1.0
ATGGCTTCTCCTCTTCTGATTCTTGCGCCGATGGAATCTAGGGCGATTCCTCCACTGAATAGATTGAAGCGAGAAGCCAATTGTTCAAGACAGCAAGGGA
AAAGAAGAAGAAGAAGAGGTTCAAGGATTGCTGCAATGGACGCGGATTTAGTTGTATCGACGACCGCCGTAACGCAGCAGGCGGTTACGTGGGAGATTGC
GGTGGGAGCTATAGCCGGAGTGACGCCGTTCGTGGTTGCCGGGATAGAGTTCAGCAAAAGAATAATGGCACAGAGAAGATGTGAATTGTGCGATGGGTCA
GGGCTGATTCTAATGGATGATGATGATAAGAAAGAGTATTGTCGCTGCCCAGGATGTGGTGGATTTCTACCATGGCAGTCCTGGAAAAGATTCTTCACCG
GCTAA
AA sequence
>Lus10008950 pacid=23175174 polypeptide=Lus10008950 locus=Lus10008950.g ID=Lus10008950.BGIv1.0 annot-version=v1.0
MASPLLILAPMESRAIPPLNRLKREANCSRQQGKRRRRRGSRIAAMDADLVVSTTAVTQQAVTWEIAVGAIAGVTPFVVAGIEFSKRIMAQRRCELCDGS
GLILMDDDDKKEYCRCPGCGGFLPWQSWKRFFTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55570 unknown protein Lus10008950 0 1
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10026238 2.0 0.9469
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 2.4 0.9436
Lus10017075 2.6 0.9364
AT4G27030 FADA, FAD4 FATTY ACID DESATURASE 4, fatty... Lus10037808 3.5 0.9418
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10030141 3.9 0.9431
AT5G64840 ABCF5, ATGCN5 ATP-binding cassette F5, gener... Lus10005798 4.5 0.9399
AT5G24120 ATSIG5, SIG5, S... SIGMA FACTOR 5, sigma factor E... Lus10038823 5.5 0.9380
AT2G37970 SOUL-1 SOUL heme-binding family prote... Lus10017193 6.0 0.9333
AT3G02380 CO ATCOL2, COL2 CONSTANS-like 2 (.1) Lus10005106 6.3 0.9361
AT3G21750 UGT71B1 UDP-glucosyl transferase 71B1 ... Lus10026795 7.7 0.9302

Lus10008950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.