Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04870 70 / 1e-15 AK1, ATCPK1, CPK1 calcium dependent protein kinase 1 (.1) AT3G10660 62 / 5e-13 ATCPK2, CPK2 calmodulin-domain protein kinase cdpk isoform 2 (.1) AT2G38910 52 / 2e-09 CPK20 calcium-dependent protein kinase 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028862 [exp] 133 / 5e-38 AT5G04870 940 / 0.0 calcium dependent protein kinase 1 (.1) Lus10016200 [exp] 44 / 2e-06 AT2G38910 868 / 0.0 calcium-dependent protein kinase 20 (.1) Lus10015992 [exp] 40 / 3e-05 AT2G38910 880 / 0.0 calcium-dependent protein kinase 20 (.1) Lus10012285 [exp] 39 / 0.0001 AT2G38910 884 / 0.0 calcium-dependent protein kinase 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G244800 [exp] 87 / 7e-22 AT5G04870 899 / 0.0 calcium dependent protein kinase 1 (.1) Potri.008G014700 [exp] 86 / 3e-21 AT5G04870 922 / 0.0 calcium dependent protein kinase 1 (.1) Potri.006G199400 [exp] 52 / 3e-09 AT2G38910 899 / 0.0 calcium-dependent protein kinase 20 (.1) Potri.006G200600 [exp] 48 / 5e-08 AT5G04870 842 / 0.0 calcium dependent protein kinase 1 (.1) Potri.016G065700 [exp] 48 / 6e-08 AT2G38910 892 / 0.0 calcium-dependent protein kinase 20 (.1) Potri.016G066700 [exp] 40 / 2e-05 AT3G10660 834 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008957 pacid=23175112 polypeptide=Lus10008957 locus=Lus10008957.g ID=Lus10008957.BGIv1.0 annot-version=v1.0 ATGGGTAATAACTGCGTTGGACCAAGTGCTACCAAGAATGGCTTTCTCCAGACAGTTTCCGCTGCAATGTGGAGATCCAGATTGCCAGATGATGCAGCAG CAGCTGCTGCTGCTCAGGGAAATGGTGAAACTGTGACTGATAAAGAAGTGCCTTTCGAGGTCCAGGATAAGCCCCCGGAGCAAGTTACCATCCCTAAACC GGAGAAAAGAGAGGATCCTAGATCAGAAGCAGCCTGA
AA sequence Show only first row Show all	>Lus10008957 pacid=23175112 polypeptide=Lus10008957 locus=Lus10008957.g ID=Lus10008957.BGIv1.0 annot-version=v1.0 MGNNCVGPSATKNGFLQTVSAAMWRSRLPDDAAAAAAAQGNGETVTDKEVPFEVQDKPPEQVTIPKPEKREDPRSEAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Lus10008957 [exp]	0	1
AT5G19400		SMG7	Telomerase activating protein ...		Lus10009689 [exp]	2.2	0.8175
AT3G55020			Ypt/Rab-GAP domain of gyp1p su...		Lus10041425 [exp]	10.1	0.8080
AT1G71270		ATVPS52, TTD8, ...	T-DNA TRANSMISSION DEFECT 8, P...		Lus10040815 [exp]	17.1	0.7400
AT3G10550		MTM1, AtMTM1	Arabidopsis thaliana myotubula...		Lus10037915 [exp]	17.5	0.7625
AT3G56680			Single-stranded nucleic acid b...		Lus10034141 [exp]	23.2	0.6855
AT2G24300			Calmodulin-binding protein (.1...		Lus10019056 [exp]	27.3	0.7901
AT4G10730			Protein kinase superfamily pro...		Lus10001677 [exp]	36.9	0.6787
AT2G15900			Phox-associated domain;Phox-li...		Lus10027939 [exp]	44.5	0.7014
AT5G22450			unknown protein		Lus10020607 [exp]	49.5	0.7232
AT1G79350		EMB1135	embryo defective 1135, RING/FY...		Lus10001760 [exp]	49.6	0.7179

Compare expression of checked genes

Lus10008957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.