Lus10008975 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40190 188 / 6e-59 LEW3 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
AT1G78800 52 / 1e-08 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007500 204 / 8e-65 AT2G40190 745 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10028977 203 / 1e-64 AT2G40190 751 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10010207 112 / 3e-33 AT2G40190 111 / 6e-30 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10014773 80 / 2e-18 AT2G40190 188 / 1e-55 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10037008 52 / 8e-09 AT1G78800 665 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015797 50 / 5e-08 AT1G78800 652 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G095500 174 / 1e-53 AT2G40190 735 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Potri.015G093000 142 / 5e-44 AT2G40190 248 / 2e-81 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G109000 53 / 6e-09 AT1G78800 663 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00534 Glycos_transf_1 Glycosyl transferases group 1
Representative CDS sequence
>Lus10008975 pacid=23175178 polypeptide=Lus10008975 locus=Lus10008976.g ID=Lus10008975.BGIv1.0 annot-version=v1.0
ATGTACAGGGACTTGATAAAGCTACTGGGAAGTGCCGTTGCAGGATTACATTCTATGATAGACGAGCACTTTGGCATCAGTGTTGTTGAATACATGGCTG
CAGGAGCCATACCAATAGCTCATAACTCCACGGGTCCTAAAATGGGCATTGTGCTAGAAGAAGACGGGGAGCCGACAGGGTTCCTTGCAGAGACAGTTGA
AGAGTTTGCAGACGCGATCCTCAAGGTGGTCAAGATGCCGGAACCCGGGAGGCTCAAGATGGCTGCTGACGCCAGGAGAAGGGCCGGCAAGTTTTCGGAA
CAAAGGTTTTACGAGAATCTCAAAACTTCCATTCGACCTGTACTAGTACCAAGTGTTTCTTCCACCAATACCAGATAA
AA sequence
>Lus10008975 pacid=23175178 polypeptide=Lus10008975 locus=Lus10008976.g ID=Lus10008975.BGIv1.0 annot-version=v1.0
MYRDLIKLLGSAVAGLHSMIDEHFGISVVEYMAAGAIPIAHNSTGPKMGIVLEEDGEPTGFLAETVEEFADAILKVVKMPEPGRLKMAADARRRAGKFSE
QRFYENLKTSIRPVLVPSVSSTNTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10008975 0 1
AT3G11570 TBL8 TRICHOME BIREFRINGENCE-LIKE 8 ... Lus10017004 3.2 0.7887
AT3G11570 TBL8 TRICHOME BIREFRINGENCE-LIKE 8 ... Lus10021328 4.9 0.7697
AT5G43680 unknown protein Lus10004356 12.4 0.7622
AT2G13600 Pentatricopeptide repeat (PPR)... Lus10032363 13.2 0.7226
AT2G04940 scramblase-related (.1) Lus10010075 15.1 0.7614
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Lus10014175 17.8 0.7685
AT3G02100 UDP-Glycosyltransferase superf... Lus10021163 18.0 0.7442
AT4G35230 BSK1 BR-signaling kinase 1 (.1) Lus10003329 18.1 0.7547
AT3G13600 calmodulin-binding family prot... Lus10025173 20.1 0.7122
AT1G53710 Calcineurin-like metallo-phosp... Lus10042936 20.5 0.7561

Lus10008975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.