Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59810 104 / 2e-27 ATSBT5.4 Subtilase family protein (.1) AT2G04160 99 / 2e-25 AIR3 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) AT4G10550 84 / 4e-20 Subtilase family protein (.1.2.3) AT4G10540 83 / 1e-19 Subtilase family protein (.1) AT4G21640 82 / 2e-19 Subtilase family protein (.1) AT4G21650 82 / 3e-19 Subtilase family protein (.1) AT1G66210 81 / 6e-19 Subtilisin-like serine endopeptidase family protein (.1) AT1G32940 80 / 2e-18 ATSBT3.5 Subtilase family protein (.1) AT1G66220 79 / 2e-18 Subtilase family protein (.1) AT5G11940 79 / 2e-18 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016064 [exp] 107 / 2e-28 AT2G04160 975 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10039085 [exp] 100 / 1e-25 AT5G59810 827 / 0.0 Subtilase family protein (.1) Lus10032096 [exp] 96 / 3e-24 AT1G20160 654 / 0.0 Subtilisin-like serine endopeptidase family protein (.1.2) Lus10014591 [exp] 96 / 5e-24 AT2G04160 716 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10038774 [exp] 94 / 1e-23 AT5G59810 839 / 0.0 Subtilase family protein (.1) Lus10039086 [exp] 94 / 2e-23 AT5G59810 850 / 0.0 Subtilase family protein (.1) Lus10038772 [exp] 94 / 2e-23 AT5G59810 815 / 0.0 Subtilase family protein (.1) Lus10039087 [exp] 93 / 4e-23 AT2G04160 810 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10032425 [exp] 89 / 9e-22 AT5G59810 607 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G050300 [exp] 108 / 7e-29 AT2G04160 786 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G050100 [exp] 108 / 8e-29 AT2G04160 784 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G050000 [exp] 106 / 5e-28 AT2G04160 806 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.006G001600 [exp] 100 / 6e-26 AT5G59810 970 / 0.0 Subtilase family protein (.1) Potri.014G171600 [exp] 100 / 9e-26 AT2G04160 986 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.001G468900 [exp] 99 / 4e-25 AT5G59810 730 / 0.0 Subtilase family protein (.1) Potri.007G102100 [exp] 98 / 5e-25 AT2G04160 817 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.007G102250 [exp] 98 / 5e-25 AT2G04160 821 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.001G469000 [exp] 97 / 2e-24 AT5G59810 754 / 0.0 Subtilase family protein (.1) Potri.011G165900 [exp] 96 / 4e-24 AT2G04160 882 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008982 pacid=23175128 polypeptide=Lus10008982 locus=Lus10008982.g ID=Lus10008982.BGIv1.0 annot-version=v1.0 ATGACCGACTTAGCTGGAGGGAAGGCCAACCCATTAGGTTACGGATCAGGGCACATCAGGCCGAATCAGGCTGCAGATCCAGGACTTGTGTACGAGGTGG CTAACCACGAGTACTTGGATTTCCTCCGCTCTCTAGGCTACAACAGCTCCTCCATTGACAAGTTCAAAAAGGGTTACGGATGTCCAGAATCTGGTCACAG TGTATCTGATTTCAACTACCCTTCGATATCGATCCCTAACCTTCAGACAAGTTCGGTAACTGTTACAAGGACAGTCAAGAATGTGCGTTCATCTACTGCA ATTTATGTTACTAAGGTGAAAGAGCTGTCGGGGTTTCGGTGA
AA sequence Show only first row Show all	>Lus10008982 pacid=23175128 polypeptide=Lus10008982 locus=Lus10008982.g ID=Lus10008982.BGIv1.0 annot-version=v1.0 MTDLAGGKANPLGYGSGHIRPNQAADPGLVYEVANHEYLDFLRSLGYNSSSIDKFKKGYGCPESGHSVSDFNYPSISIPNLQTSSVTVTRTVKNVRSSTA IYVTKVKELSGFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10008982 [exp]	0	1
AT2G15220			Plant basic secretory protein ...		Lus10014111 [exp]	8.1	0.7738
AT2G28085			SAUR-like auxin-responsive pro...		Lus10016130 [exp]	9.6	0.8484
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Lus10029358 [exp]	15.9	0.8378
AT2G30900		TBL43	TRICHOME BIREFRINGENCE-LIKE 43...		Lus10020786 [exp]	18.6	0.8231
					Lus10039897 [exp]	20.4	0.8123
					Lus10013379 [exp]	25.8	0.8012
AT4G34770			SAUR-like auxin-responsive pro...		Lus10007564 [exp]	28.7	0.8097
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Lus10000154 [exp]	29.5	0.7530
					Lus10018225 [exp]	35.5	0.7956
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10020083 [exp]	36.5	0.7917

Compare expression of checked genes

Lus10008982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.