Lus10008986 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 185 / 4e-57 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 72 / 2e-14 Cysteine proteinases superfamily protein (.1)
AT2G27350 42 / 0.0005 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028840 540 / 0 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10020438 192 / 4e-59 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10015803 178 / 8e-56 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002 177 / 2e-55 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10005193 44 / 0.0001 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10013303 44 / 0.0001 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 41 / 0.0008 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G234300 290 / 1e-97 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 278 / 1e-92 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G050900 194 / 2e-59 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G177400 187 / 3e-59 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400 183 / 2e-55 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 77 / 2e-16 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.004G196800 50 / 1e-06 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.010G057750 43 / 1e-05 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.009G160100 44 / 0.0001 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 42 / 0.0004 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10008986 pacid=23175187 polypeptide=Lus10008986 locus=Lus10008986.g ID=Lus10008986.BGIv1.0 annot-version=v1.0
ATGCTTGGTATTCTCCGTCCGGGACCCAAGCCGTGGATTCTGACTTCTCTGGCCAATCATTTTCACGGCCACTCTCCGGCGTACTATAGCCGCCACCTCA
ACAACTCTCCTTTCAAATCCTCTCCGGATGATTCCTCCTCCGCTGTCCTCCGTGGCGTCTCCAACTCTTGCCGCCTTGTAGATTCTCTATGGCATATCCA
GTCCTCTTCCTGCAGCAGCTGCATCCGCTCCCTCGTTGAGCCTCCTAGAGGAGAAGGCTCGTGGAACGTCGTGTGGGATGCACGCCCTGCGCGGTGGTTA
ACCCGTCCGGACTCCGCCTGGATTCTCTTCGGTGCTTGTCATGCTCCGATTGAATTCTGGTTGGCGAACCCAGCGGATAATACTGTTCCGACTGCTGATC
AAGCGGGAGTTGGACGAAACGATGATGCTAGTCCAGCTGCCGGTTTCGAAGTGAAGAACGAGACGTCTGCTAATTACAAGGTCACAGGCGTGCTTGCTGA
TGGGAGATGTTTGTTTAGAGCAATAGCTCATGGTGATTGCCTAAGGAATGGGAAAGAAGCTCCTGACGAAGATTGCCAACGACAGCTCGCTGATGAACTA
AGAGCTCAAGTAGCTAAGGAGCTTTCGAAGAGGCGGAAAGAAGTCGAATGCTTCATCGAAGAAGATTTCGATACATATGTCAACAGAATACAGCAGCCTT
ATGTATGGGGTGGAGAGCCTGAATTGTTGATGTCCTCCCATATTCTGAAGACGATGATATCGGTCTTCATGATGGACCGGATATCTGGCGATCTAGTGAG
CATAACAAGCTATGGTGAAGAGTATGGGAAAGGTGGAGAGAACCCCATTAACGTGCTGTTTCATGGATATGGTCACTATGACTTGTTGGAGGGGTTGAAC
AAGAGTTACCAGCAGAAAGCCAACGTATAG
AA sequence
>Lus10008986 pacid=23175187 polypeptide=Lus10008986 locus=Lus10008986.g ID=Lus10008986.BGIv1.0 annot-version=v1.0
MLGILRPGPKPWILTSLANHFHGHSPAYYSRHLNNSPFKSSPDDSSSAVLRGVSNSCRLVDSLWHIQSSSCSSCIRSLVEPPRGEGSWNVVWDARPARWL
TRPDSAWILFGACHAPIEFWLANPADNTVPTADQAGVGRNDDASPAAGFEVKNETSANYKVTGVLADGRCLFRAIAHGDCLRNGKEAPDEDCQRQLADEL
RAQVAKELSKRRKEVECFIEEDFDTYVNRIQQPYVWGGEPELLMSSHILKTMISVFMMDRISGDLVSITSYGEEYGKGGENPINVLFHGYGHYDLLEGLN
KSYQQKANV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57810 Cysteine proteinases superfami... Lus10008986 0 1
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Lus10002359 1.7 0.8421
AT2G16770 bZIP bZIP23 Basic-leucine zipper (bZIP) tr... Lus10019788 3.6 0.8698
AT1G65410 ABCI13, TGD3, A... TRIGALACTOSYLDIACYLGLYCEROL 3,... Lus10020188 4.9 0.8098
AT2G21340 MATE efflux family protein (.1... Lus10042074 5.2 0.8126
AT2G23140 RING/U-box superfamily protein... Lus10011514 5.3 0.8388
AT5G04830 Nuclear transport factor 2 (NT... Lus10008971 6.0 0.8244
AT2G20440 Ypt/Rab-GAP domain of gyp1p su... Lus10043064 7.3 0.7824
AT5G44800 PKR1, CHR4, MI-... PICKLE RELATED 1, chromatin re... Lus10036224 7.4 0.8106
AT3G07940 Calcium-dependent ARF-type GTP... Lus10039538 12.4 0.7955
AT1G18390 Protein kinase superfamily pro... Lus10029132 12.4 0.8447

Lus10008986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.