Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) AT4G34770 107 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT2G21210 106 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT5G18060 105 / 3e-31 SAUR-like auxin-responsive protein family (.1) AT3G03840 105 / 4e-31 SAUR-like auxin-responsive protein family (.1) AT2G21200 105 / 4e-31 SAUR-like auxin-responsive protein family (.1) AT5G18020 104 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT5G18050 104 / 9e-31 SAUR-like auxin-responsive protein family (.1) AT3G03850 104 / 1e-30 SAUR-like auxin-responsive protein family (.1) AT5G18030 103 / 2e-30 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009620 [exp] 173 / 9e-58 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 167 / 2e-55 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 165 / 2e-54 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 161 / 5e-53 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 161 / 5e-53 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 155 / 8e-51 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 154 / 2e-50 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 152 / 2e-49 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 151 / 3e-49 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 140 / 9e-45 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 133 / 6e-42 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 130 / 6e-41 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 130 / 9e-41 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 125 / 4e-39 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 119 / 1e-36 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 118 / 4e-36 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 114 / 1e-34 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 109 / 1e-32 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 107 / 5e-32 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10008991 pacid=23173355 polypeptide=Lus10008991 locus=Lus10008991.g ID=Lus10008991.BGIv1.0 annot-version=v1.0 ATGGCTATTGGGTTGCCTGGTAACCTCGTCAAGCAGATTCTACGACGAACTGGCTCCAGAATAAGTAAAGGGTCATCACGGTTTCAAGATGTGCCAAAGG GGTTCTTAGGGGTGTATGTTGGAGAAGAGACACAAAGGAAGAGATTTGTGGTGCCGGTATCGTATTTGAGCCAGCCCTTGTTTCAGGATCTGTTGAGCAT TGCTGAAGAGGAATTCGGATTCAATCATCCGATGGGTGGATTGACCATTCCATGTAGTGAACAAGCTTTCATTTCTGCTACTTCAAACTTGAACAGAACA TGA
AA sequence Show only first row Show all	>Lus10008991 pacid=23173355 polypeptide=Lus10008991 locus=Lus10008991.g ID=Lus10008991.BGIv1.0 annot-version=v1.0 MAIGLPGNLVKQILRRTGSRISKGSSRFQDVPKGFLGVYVGEETQRKRFVVPVSYLSQPLFQDLLSIAEEEFGFNHPMGGLTIPCSEQAFISATSNLNRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008991 [exp]	0	1
AT5G27780			SAUR-like auxin-responsive pro...		Lus10023969 [exp]	1.4	0.9692
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009628 [exp]	2.0	0.9700
AT1G26945	bHLH	KDR, PRE6	KIDARI, basic helix-loop-helix...		Lus10037198 [exp]	2.0	0.9650
AT1G29430			SAUR-like auxin-responsive pro...		Lus10025115 [exp]	3.2	0.9636
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009001 [exp]	3.5	0.9658
					Lus10031379 [exp]	5.3	0.9514
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10040484 [exp]	7.7	0.9591
AT4G12690			Plant protein of unknown funct...		Lus10006223 [exp]	7.9	0.9595
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	8.0	0.9483
AT3G45780		RPT1, NPH1, JK2...	ROOT PHOTOTROPISM 1, NONPHOTOT...		Lus10036144 [exp]	8.1	0.9400

Compare expression of checked genes

Lus10008991 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.