Lus10008994 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18050 112 / 3e-33 SAUR-like auxin-responsive protein family (.1)
AT2G21200 112 / 4e-33 SAUR-like auxin-responsive protein family (.1)
AT5G18020 112 / 6e-33 SAUR-like auxin-responsive protein family (.1)
AT5G18030 111 / 1e-32 SAUR-like auxin-responsive protein family (.1)
AT5G18080 111 / 2e-32 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
AT5G18060 110 / 3e-32 SAUR-like auxin-responsive protein family (.1)
AT4G38840 109 / 8e-32 SAUR-like auxin-responsive protein family (.1)
AT5G18010 108 / 2e-31 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1)
AT4G38825 107 / 8e-31 SAUR-like auxin-responsive protein family (.1)
AT3G03840 105 / 4e-30 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009628 146 / 2e-46 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Lus10009623 146 / 2e-46 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Lus10009000 144 / 3e-45 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1)
Lus10009624 141 / 2e-44 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1)
Lus10009627 140 / 8e-44 AT4G38840 118 / 3e-36 SAUR-like auxin-responsive protein family (.1)
Lus10009001 135 / 7e-42 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1)
Lus10025910 133 / 3e-41 AT4G38840 117 / 9e-36 SAUR-like auxin-responsive protein family (.1)
Lus10038191 131 / 3e-40 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Lus10038193 129 / 2e-39 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G126700 124 / 1e-37 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G126500 119 / 2e-35 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Potri.009G126300 115 / 2e-34 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G165200 113 / 3e-33 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G164800 111 / 1e-32 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Potri.009G126400 110 / 4e-32 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
Potri.009G126900 109 / 9e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
Potri.004G164600 109 / 1e-31 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1)
Potri.004G165300 106 / 1e-30 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
Potri.004G165450 106 / 2e-30 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10008994 pacid=23173325 polypeptide=Lus10008994 locus=Lus10008994.g ID=Lus10008994.BGIv1.0 annot-version=v1.0
ATGGCTATTGGATTGCCTGGTAATCTTGCTAAGCAGATCCTCCGACGATCTTGGTCCGGATCGAGCAAAGGATCCTCTTCAAGGTTTCAAGATGTTCCCA
AGGGGTACTTAGCGGTATATATTGGTGAGACACAGAGGAAGAGATTCGTGGTACCAGTTTCATACTTGAGCCGGTCTGAATTTCAAGACTTGTTGAGCAT
GGCTGAGGAGGAATTCGGGTTTGATCATCCAATGGGTGGCCTTACCATTCCATGCAATGTGCCAAAGGGTTACTTAGCAGTTTATGTTGGAGAGACACAG
AAGAAGAGATTTCTAGTGCCAGTTTCGTGTCTGAGCCAGCCCTCGTTTCAAGACTTGCTGAGCATGGCTGAAGACGAGTTCGGGTTTGATCATCCGATGG
GTGGATTGACCATTCCTTGCAGTGAAGAAACCTTTATTTCTGCCACTTCAAACTTGAGCAGGCCATGA
AA sequence
>Lus10008994 pacid=23173325 polypeptide=Lus10008994 locus=Lus10008994.g ID=Lus10008994.BGIv1.0 annot-version=v1.0
MAIGLPGNLAKQILRRSWSGSSKGSSSRFQDVPKGYLAVYIGETQRKRFVVPVSYLSRSEFQDLLSMAEEEFGFDHPMGGLTIPCNVPKGYLAVYVGETQ
KKRFLVPVSCLSQPSFQDLLSMAEDEFGFDHPMGGLTIPCSEETFISATSNLSRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18050 SAUR-like auxin-responsive pro... Lus10008994 0 1
AT4G38840 SAUR-like auxin-responsive pro... Lus10009000 1.0 0.9898
AT4G38840 SAUR-like auxin-responsive pro... Lus10009624 2.0 0.9649
AT4G38840 SAUR-like auxin-responsive pro... Lus10009627 2.4 0.9585
AT4G38840 SAUR-like auxin-responsive pro... Lus10008996 2.8 0.9558
AT4G38840 SAUR-like auxin-responsive pro... Lus10010714 3.2 0.9381
AT4G34770 SAUR-like auxin-responsive pro... Lus10025909 3.5 0.9257
AT4G34770 SAUR-like auxin-responsive pro... Lus10038192 5.3 0.9036
AT5G11420 Protein of unknown function, D... Lus10013112 5.5 0.8673
AT5G54250 HLM1, DND2, ATC... DEFENSE, NO DEATH 2, cyclic nu... Lus10010061 5.7 0.8989
AT5G57970 DNA glycosylase superfamily pr... Lus10038388 6.7 0.8923

Lus10008994 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.