Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18020 110 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT4G38840 110 / 5e-33 SAUR-like auxin-responsive protein family (.1) AT5G18030 107 / 5e-32 SAUR-like auxin-responsive protein family (.1) AT3G03840 107 / 6e-32 SAUR-like auxin-responsive protein family (.1) AT5G18080 107 / 9e-32 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 106 / 1e-31 SAUR-like auxin-responsive protein family (.1) AT4G34770 106 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT5G18050 105 / 3e-31 SAUR-like auxin-responsive protein family (.1) AT2G21200 104 / 6e-31 SAUR-like auxin-responsive protein family (.1) AT5G18010 103 / 1e-30 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009624 [exp] 149 / 2e-48 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1) Lus10009000 [exp] 148 / 6e-48 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1) Lus10009627 [exp] 147 / 9e-48 AT4G38840 118 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10038191 [exp] 144 / 1e-46 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10025910 [exp] 144 / 3e-46 AT4G38840 117 / 9e-36 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 139 / 3e-44 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 138 / 4e-44 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 138 / 4e-44 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 138 / 5e-44 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126300 [exp] 125 / 6e-39 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 125 / 6e-39 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 122 / 1e-37 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 115 / 7e-35 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 114 / 2e-34 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 112 / 8e-34 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 110 / 5e-33 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 106 / 2e-31 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 104 / 6e-31 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 103 / 3e-30 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10008996 pacid=23173334 polypeptide=Lus10008996 locus=Lus10008996.g ID=Lus10008996.BGIv1.0 annot-version=v1.0 ATGGCCATCGGGTTGCCTGGTAACCTTGCTAAGCAGATTCTCCGAAGATCCGGATCCGGATCGAGCAGAAGATCCTTCTCAAGGTTTCAAGATGTGCCAA AGGGATACTTAGCGGTATATGTTGGAGAAACACAGAGGAAGAGATTCGTTGTTCTAGTGTCCTATCTGAGCCAGCCTTTGTTTCAGGGTTTTTTGAGCAT GGCCGAGGAGGAATTCGGATTTGATCATCCAATGGGTGGATTGACCATTCCTTGCAGTGAAGAAACTTTTGTTTCCGTTACTTCAAGCTTTAGCAGATAA
AA sequence Show only first row Show all	>Lus10008996 pacid=23173334 polypeptide=Lus10008996 locus=Lus10008996.g ID=Lus10008996.BGIv1.0 annot-version=v1.0 MAIGLPGNLAKQILRRSGSGSSRRSFSRFQDVPKGYLAVYVGETQRKRFVVLVSYLSQPLFQGFLSMAEEEFGFDHPMGGLTIPCSEETFVSVTSSFSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008996 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009000 [exp]	1.7	0.9589
AT5G54250		HLM1, DND2, ATC...	DEFENSE, NO DEATH 2, cyclic nu...		Lus10010061 [exp]	1.7	0.9293
AT5G18050			SAUR-like auxin-responsive pro...		Lus10008994 [exp]	2.8	0.9558
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10042192 [exp]	3.7	0.9089
					Lus10040168 [exp]	3.9	0.8649
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009624 [exp]	4.5	0.9194
AT5G62360			Plant invertase/pectin methyle...		Lus10031717 [exp]	4.9	0.9067
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009627 [exp]	5.0	0.9163
AT4G29310			Protein of unknown function (D...		Lus10034991 [exp]	5.3	0.8667
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010714 [exp]	5.5	0.9098

Compare expression of checked genes

Lus10008996 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.