Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08400 111 / 3e-31 Protein of unknown function (DUF3531) (.1), Protein of unknown function (DUF3531) (.2) AT4G29400 66 / 3e-14 Protein of unknown function (DUF3531) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009625 [exp] 128 / 5e-38 AT5G08400 409 / 6e-145 Protein of unknown function (DUF3531) (.1), Protein of unknown function (DUF3531) (.2) Lus10032701 [exp] 67 / 1e-14 AT4G29400 307 / 1e-104 Protein of unknown function (DUF3531) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G255300 [exp] 111 / 3e-31 AT5G08400 438 / 4e-156 Protein of unknown function (DUF3531) (.1), Protein of unknown function (DUF3531) (.2) Potri.014G148300 [exp] 66 / 4e-14 AT4G29400 337 / 1e-116 Protein of unknown function (DUF3531) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12049 [flax] [poplar] DUF3531 Protein of unknown function (DUF3531)
Representative CDS sequence Show only first row Show all	>Lus10008997 pacid=23173354 polypeptide=Lus10008997 locus=Lus10008997.g ID=Lus10008997.BGIv1.0 annot-version=v1.0 ATGCAGGTTATTCAGTCCTGGTATGTCATGGGCAGCTTGGGTTGTTTCAACTCTTCAAATCTTCAGTTGGGAAGTTCATCAATGGAATATGATCCGCTCT ATGATGCAGAGAAAGCATCACAGGCAATGCCGTCATCATTCCACGACATTGGGGATGTCGAGTTTCAGGACAATTGGGGCCGTGTCTGGTATGAGTTTCG TAATCATCATGATAATAATTTGTCTAGAAGATTTAAAAACCCGAGCTTGCGTGTGTTACAGGGTAGACCTTGGTACATGTGA
AA sequence Show only first row Show all	>Lus10008997 pacid=23173354 polypeptide=Lus10008997 locus=Lus10008997.g ID=Lus10008997.BGIv1.0 annot-version=v1.0 MQVIQSWYVMGSLGCFNSSNLQLGSSSMEYDPLYDAEKASQAMPSSFHDIGDVEFQDNWGRVWYEFRNHHDNNLSRRFKNPSLRVLQGRPWYM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08400			Protein of unknown function (D...		Lus10008997 [exp]	0	1
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	15.4	0.7209
					Lus10016852 [exp]	28.1	0.6717
AT1G27180			disease resistance protein (TI...		Lus10000423 [exp]	32.7	0.6839
AT5G21060			Glyceraldehyde-3-phosphate deh...		Lus10034077 [exp]	99.0	0.6310
AT4G36860		DAR1	DA1-RELATED PROTEIN 1, LIM dom...		Lus10000138 [exp]	109.0	0.5989
					Lus10026002 [exp]	114.6	0.5766
AT2G18465			Chaperone DnaJ-domain superfam...		Lus10033506 [exp]	114.7	0.5545
					Lus10039434 [exp]	118.3	0.5989
AT3G13860		HSP60-3A	heat shock protein 60-3A (.1)		Lus10003791 [exp]	153.4	0.6113
					Lus10020450 [exp]	213.7	0.5728

Compare expression of checked genes

Lus10008997 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.