Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 122 / 1e-37 SAUR-like auxin-responsive protein family (.1) AT5G18080 114 / 1e-34 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT2G21200 113 / 3e-34 SAUR-like auxin-responsive protein family (.1) AT5G18030 112 / 1e-33 SAUR-like auxin-responsive protein family (.1) AT5G18020 110 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT4G38825 110 / 3e-33 SAUR-like auxin-responsive protein family (.1) AT5G18060 109 / 7e-33 SAUR-like auxin-responsive protein family (.1) AT5G18010 109 / 8e-33 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT5G18050 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT3G03840 106 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009628 [exp] 169 / 4e-56 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 169 / 4e-56 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 163 / 8e-54 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 161 / 3e-53 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 160 / 6e-53 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 160 / 7e-53 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 161 / 8e-53 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 156 / 4e-51 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 154 / 3e-50 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 146 / 2e-47 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 143 / 5e-46 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 133 / 5e-42 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 131 / 3e-41 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 129 / 2e-40 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 126 / 2e-39 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 122 / 5e-38 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 119 / 2e-36 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 113 / 3e-34 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 113 / 4e-34 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10009001 pacid=23173356 polypeptide=Lus10009001 locus=Lus10009001.g ID=Lus10009001.BGIv1.0 annot-version=v1.0 ATGGCTATTGGATTGCCTGGTAACCTTGTCAAGCAAATTCTCCGACAAACTGGCTCCGGTTCATTCAAAGGATCATCAAGGTTTGCAGATGTGCCAAAGG GTTACTTAGCTGTCTATGTTGGAGAGACACAGAAGAAGAGATTTGTTGTGCCGGTTTCGTGTTTGAGCCAGCATTCGTTTCAAGACTTGCTAAGCATGGC TGAAGAAGAATTCGGGTTTGATCATCCAATGGGTGGATTGACCATTCCTTGTAGTGAAGAGACATTTGTTTCTGTTACTTCAAACTTGAGCAGACGATGA
AA sequence Show only first row Show all	>Lus10009001 pacid=23173356 polypeptide=Lus10009001 locus=Lus10009001.g ID=Lus10009001.BGIv1.0 annot-version=v1.0 MAIGLPGNLVKQILRQTGSGSFKGSSRFADVPKGYLAVYVGETQKKRFVVPVSCLSQHSFQDLLSMAEEEFGFDHPMGGLTIPCSEETFVSVTSNLSRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009001 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009628 [exp]	1.0	0.9917
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	2.0	0.9863
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009486 [exp]	2.4	0.9728
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008991 [exp]	3.5	0.9658
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10040484 [exp]	7.7	0.9488
AT1G29430			SAUR-like auxin-responsive pro...		Lus10025115 [exp]	8.5	0.9409
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	8.5	0.9421
AT1G32780			GroES-like zinc-binding dehydr...		Lus10033241 [exp]	8.8	0.9365
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10003717 [exp]	10.4	0.9481
AT5G27780			SAUR-like auxin-responsive pro...		Lus10023969 [exp]	12.3	0.9271

Compare expression of checked genes

Lus10009001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.