Lus10009027 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18410 182 / 4e-61 Complex I subunit NDUFS6 (.1.2)
AT1G49140 177 / 4e-59 Complex I subunit NDUFS6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009665 205 / 4e-69 AT3G18410 174 / 9e-57 Complex I subunit NDUFS6 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G056900 205 / 3e-70 AT1G49140 181 / 7e-61 Complex I subunit NDUFS6 (.1)
Potri.015G054700 201 / 1e-68 AT1G49140 149 / 3e-48 Complex I subunit NDUFS6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10249 NDUFB10 NADH-ubiquinone oxidoreductase subunit 10
Representative CDS sequence
>Lus10009027 pacid=23173367 polypeptide=Lus10009027 locus=Lus10009027.g ID=Lus10009027.BGIv1.0 annot-version=v1.0
ATGGGGAGGAAGAAAGGAGTGGCGGAATTCGAGGAGTCGCCGCCGGACGACTTCGATCCGGCGGATCCATACAAGGATCCGGTGGCGATGCTGGAGATGA
GGGAGCACATCGTGAGGGAGAAGTGGATCGACATCGAGAGGTCCAAGATCCTGAGGGAGAGGCTCCGGTGGTGCTACCGCGTCGAAGGTGTCAACCACCT
CCAGAAGTGCCGCCACCTCGTCGAGCAGTACCTCGACTCCACTCGCGGAATCGGATGGGGCAAGGATCACCGCCCCCCTTGCCTTCACGGCCCTAAGGTG
GAAGCGGAAGCGACGGAGGCCGAATGA
AA sequence
>Lus10009027 pacid=23173367 polypeptide=Lus10009027 locus=Lus10009027.g ID=Lus10009027.BGIv1.0 annot-version=v1.0
MGRKKGVAEFEESPPDDFDPADPYKDPVAMLEMREHIVREKWIDIERSKILRERLRWCYRVEGVNHLQKCRHLVEQYLDSTRGIGWGKDHRPPCLHGPKV
EAEATEAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18410 Complex I subunit NDUFS6 (.1.2... Lus10009027 0 1
AT3G18410 Complex I subunit NDUFS6 (.1.2... Lus10009665 1.0 0.9574
AT1G71780 unknown protein Lus10016547 1.4 0.9422
AT3G08780 unknown protein Lus10022677 1.7 0.9105
AT5G08530 CI51 51 kDa subunit of complex I (.... Lus10015807 2.0 0.8971
AT1G29790 S-adenosyl-L-methionine-depend... Lus10015264 2.4 0.8765
AT3G22590 PHP, CDC73 PLANT HOMOLOGOUS TO PARAFIBROM... Lus10041198 4.6 0.8737
AT4G00585 unknown protein Lus10007571 6.2 0.8604
AT5G11810 unknown protein Lus10022300 6.3 0.8661
AT3G58810 ATMTPA2, MTP3, ... ARABIDOPSIS METAL TOLERANCE PR... Lus10002674 6.8 0.8478
AT5G20650 COPT5 copper transporter 5 (.1) Lus10012501 9.2 0.8423

Lus10009027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.