Lus10009048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10009048 pacid=23173360 polypeptide=Lus10009048 locus=Lus10009048.g ID=Lus10009048.BGIv1.0 annot-version=v1.0
ATGATCAGTTCTTCCAAGTCCAGACGATGTTACAAGCCTATTACTTGTGTCGTAAAGATCCTAATAGTTCACTTGCAGTTGATTCAAGTGGTCTGTGCAG
TTTATCGCAAGATTGCTGAACTTTACTCAAGCTCTGATGATGATGATGGTGGTGGTGGTGGTGGTGGTGCAACAAATACTTTCTATGCCAGCCATCACAG
TATATGTGAGAAAGCTAGGAAAATACTTTCTATGAGCAGCCGTCACAGAATAACAGAGATTGTTGGGTTTGTTTTCTGTAACAACAGCTTGCTCAACTTT
TCCCAAGCCCTCATGATGACGATTCTGATGACGAAGAATCAACAAGGACAACAACAGAGAATGATGATGATGGTATTTTATTAA
AA sequence
>Lus10009048 pacid=23173360 polypeptide=Lus10009048 locus=Lus10009048.g ID=Lus10009048.BGIv1.0 annot-version=v1.0
MISSSKSRRCYKPITCVVKILIVHLQLIQVVCAVYRKIAELYSSSDDDDGGGGGGGATNTFYASHHSICEKARKILSMSSRHRITEIVGFVFCNNSLLNF
SQALMMTILMTKNQQGQQQRMMMMVFY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009048 0 1
AT5G53550 ATYSL3, YSL3 YELLOW STRIPE like 3 (.1.2) Lus10008836 2.4 0.8696
AT4G15130 ATCCT2 phosphorylcholine cytidylyltra... Lus10000195 2.4 0.8647
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Lus10036229 4.9 0.8420
AT1G19110 inter-alpha-trypsin inhibitor ... Lus10013159 9.8 0.8169
AT1G48880 TBL7 TRICHOME BIREFRINGENCE-LIKE 7 ... Lus10029761 15.7 0.8349
AT1G19110 inter-alpha-trypsin inhibitor ... Lus10008122 16.2 0.7569
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10007126 18.2 0.8319
AT5G49900 Beta-glucosidase, GBA2 type fa... Lus10003517 18.7 0.8364
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10009228 20.4 0.7996
AT1G71110 unknown protein Lus10007962 21.4 0.8075

Lus10009048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.