Lus10009058 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73620 376 / 3e-133 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G18250 365 / 3e-129 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75030 263 / 5e-89 ATLP-3 thaumatin-like protein 3 (.1)
AT1G75050 259 / 1e-87 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G38660 258 / 1e-85 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75040 254 / 2e-85 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G19320 254 / 3e-85 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 244 / 2e-80 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G77700 242 / 3e-79 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75800 240 / 8e-79 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032726 252 / 1e-84 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Lus10003962 248 / 8e-83 AT5G02140 387 / 4e-137 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10028447 249 / 2e-82 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041899 249 / 4e-82 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 243 / 4e-80 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028448 242 / 4e-80 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10013561 243 / 5e-80 AT4G38660 326 / 2e-112 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10023785 241 / 1e-79 AT5G02140 379 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10017266 241 / 4e-79 AT4G24180 322 / 7e-111 THAUMATIN-LIKE PROTEIN 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G047800 391 / 2e-139 AT1G73620 379 / 3e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.015G039200 387 / 9e-138 AT1G73620 352 / 1e-123 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.004G173200 268 / 2e-89 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.009G132500 267 / 4e-89 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.014G040700 259 / 2e-87 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1)
Potri.005G112600 251 / 4e-83 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.002G020400 249 / 1e-82 AT4G38660 357 / 2e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G241000 248 / 8e-82 AT4G24180 348 / 5e-121 THAUMATIN-LIKE PROTEIN 1 (.1)
Potri.002G020500 244 / 1e-80 AT1G75800 404 / 7e-142 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112700 243 / 2e-80 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10009058 pacid=23173379 polypeptide=Lus10009058 locus=Lus10009058.g ID=Lus10009058.BGIv1.0 annot-version=v1.0
ATGAACTCTCCGGCGACTCTCCTCCTCCTCACCCTCGTCGTCCTCATCTCTCAAAATGCAGTTTCATCAACGACCGTGACGTTCCTGAACAAATGCGGCC
ACCCAGTGTGGCCGGGGATCCAGCCTGGAGCAGGAAAGCCGATCCTCGCCCGCGGAGGATTCCACCTCGCGCCGAACAAGCCGTTCACTATGGCTCTGCC
AGATCTCTGGTCCGGAAGGTTCTGGGGCCGCCACGGCTGCTCATTCGATGCTTCCGGCCGAGGCCGCTGCGCTACCGGAGACTGCGGTGGCTCGCTCTAC
TGCAACGGTATGGGTGGGTCGCCGCCGGCGACTCTGGCGGAGATCACTCTGGGACATGACCAGGACTTCTATGATGTCAGCCTCGTCGACGGGTACAACA
TTCCGATGGCGGTTAAGCCGGTGAAGGGTACCGGAAAGTGTAGCTACGCCGGTTGCGTCAGCGATCTGAACTTGATGTGCCCCGCCGGACTTCAGGTCCG
GTCACGCGACAGCAGGAGTGTGGTTGCGTGCAGGAGTGCATGCTCGGCATTCAACTCGCCGAGGTACTGCTGTACGGGGGCTTTCGGGAACCCACAGACG
TGCAAGCCGACCGCCTATTCGAGGATCTTCAAGGCGGCTTGCCCAAGGGCTTACTCGTACGCTTACGATGATCCGACAAGCATTGCTACTTGCACCGGAG
GGAACTACATTGTCACCTTCTGCCCTCCTCGCCGCCGGTGA
AA sequence
>Lus10009058 pacid=23173379 polypeptide=Lus10009058 locus=Lus10009058.g ID=Lus10009058.BGIv1.0 annot-version=v1.0
MNSPATLLLLTLVVLISQNAVSSTTVTFLNKCGHPVWPGIQPGAGKPILARGGFHLAPNKPFTMALPDLWSGRFWGRHGCSFDASGRGRCATGDCGGSLY
CNGMGGSPPATLAEITLGHDQDFYDVSLVDGYNIPMAVKPVKGTGKCSYAGCVSDLNLMCPAGLQVRSRDSRSVVACRSACSAFNSPRYCCTGAFGNPQT
CKPTAYSRIFKAACPRAYSYAYDDPTSIATCTGGNYIVTFCPPRRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G73620 Pathogenesis-related thaumatin... Lus10009058 0 1
AT5G59690 Histone superfamily protein (.... Lus10014264 1.0 0.9884
AT3G02820 zinc knuckle (CCHC-type) famil... Lus10012910 2.0 0.9777
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10041347 2.8 0.9824
AT1G68400 leucine-rich repeat transmembr... Lus10035138 3.0 0.9565
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10017292 3.5 0.9792
AT5G65360 Histone superfamily protein (.... Lus10025439 4.5 0.9745
AT3G29300 unknown protein Lus10034904 5.5 0.9655
AT1G09200 Histone superfamily protein (.... Lus10005271 6.3 0.9632
AT3G02820 zinc knuckle (CCHC-type) famil... Lus10030564 6.5 0.9454
AT5G66750 CHR01, CHA1, SO... SOMNIFEROUS 1, DECREASED DNA M... Lus10024019 7.7 0.9510

Lus10009058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.